Citrus Sinensis ID: 031572

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------

MASSSYSNAPCAACKCLRRKCMPDCVFAPYFPPEEPQKFVNVHKIFGASNVSKLLNEVLPHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQRQVMRLQRELDATNADLIRYACNEMPPQFGARSDTNEQNSGFYFPSQWNNNNDGSHEGGESSSM

cccccccccccHHHHHHHcccccccccccccccccHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccc

**********CAACKCLRRKCMPDCVFAPYFPPEEPQKFVNVHKIFGASNVSKLLNEVLPHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQRQVMRLQRELDATNADLIRYACN*****************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASSSYSNAPCAACKCLRRKCMPDCVFAPYFPPEEPQKFVNVHKIFGASNVSKLLNEVLPHQREDAVNSLAYEAEARLKDPVYGCVGAxxxxxxxxxxxxxxxxxxxxxLIRYACNEMPPQFGARSDTNEQNSGFYFPSQWNNNNDGSHEGGESSSM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
LOB domain-containing protein 25		probable	Q8L8Q3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DZN, chain A
Confidence level:probable
Coverage over the Query: 87-92
View the alignment between query and template
View the model in PyMOL