Citrus Sinensis ID: 031586

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------

MKRMNKKTQIQIILKEDVAELGKKGQLLDVKAGFYRNYLHPMGKAQIVTPLLLKEMKMEEERIEAEKKRVKEEAQQLALIFETVGAFKVKRKGGKGKQIFGSVTAQDVVDIIKAQLQRDVDKKIVDLPEIRETGEYIAQLKLHPEVTARIRLNVFAN

ccccccccccEEEEEHHHccccccccEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccEEEcccHHHHHHHHHHHccccccccccccccccccEEEEEEEEEcccEEEEEEEEEEEc

*********IQIILKEDVAELGKKGQLLDVKAGFYRNYLHPMGKAQIVTPLLLK*********************QLALIFETVGAFKVKRKGGKGKQIFGSVTAQDVVDIIKAQLQRDVDKKIVDLPEIRETGEYIAQLKLHPEVTARIRLNVFAN

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKRMNKKTQIQIILKEDVAELGKKGQLLDVKAGFYRNYLHPMGKAQIVTPLLxxxxxxxxxxxxxxxxxxxxxxxxxxxxFETVGAFKVKRKGGKGKQIFGSVTAQDVVDIIKAQLQRDVDKKIVDLPEIRETGEYIAQLKLHPEVTARIRLNVFAN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
50S ribosomal protein L9, chloroplastic	Binds to the 23S rRNA.	probable	P25864
50S ribosomal protein L9, chloroplastic	Binds to the 23S rRNA.	probable	P11894
50S ribosomal protein L9	Binds to the 23S rRNA.	probable	Q31K30

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain J
Confidence level:very confident
Coverage over the Query: 10-157
View the alignment between query and template
View the model in PyMOL