Citrus Sinensis ID: 031592


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MSSLRNALPRRAHKERAQPQSRKKFGLLEKHKDYVIRAKAYHKKEESIRRLKEKAAFRNPDEFYFKMIKTKTVDGVHRLEGEANKYTQEELMLMKTQDIGYVLQKLQSERNKIEKLTTMLHSLDNNPSSRHVYFAEDRFVLSKLSFLCEDDNILDLC
ccccHHHccccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccEEEEccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEECccHHHcccccccccccccccc
*************************GLLEKHKDYVIRAKAYHKKEE****L*EKAAFRNPDEFYFKMIKTKTVDGVHRLEGEANKYTQEELMLMKTQDIGYVLQKLQ*****IEKLTTMLH********RHVYFAEDRFVLSKLSFLCEDDNILDLC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLRNALPRRAHKERAQPQSRKKFGLLEKHKDYVIRAKAYHKKEESIRRLKEKAAFRNPDEFYFKMIKTKTVDGVHRLEGEANKYTQEELMLMKTQDIGYVLQKxxxxxxxxxxxxxxxxxxxxxPSSRHVYFAEDRFVLSKLSFLCEDDNILDLC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable U3 small nucleolar RNA-associated protein 11 Involved in nucleolar processing of pre-18S ribosomal RNA.probableQ8S1Z1
Probable U3 small nucleolar RNA-associated protein 11 Involved in nucleolar processing of pre-18S ribosomal RNA.probableQ9M223

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted