Citrus Sinensis ID: 031602

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MSRVIDDVAAAVNHLFDIPETMEKFTTPSRSPHQETNKSKGVSSIPVDILDSPKDYIFFMDVPGRPKSDIQVTVEDERTLVIRSNGKRKREDGEEEGCKCIRLERRVPQKLLRKFKLPEDANVSAISAKCENGVLTIVVEKLPPPPKPKTVEVAIS
ccccHHHHHHHHHHHccccHHHcccccccccccccccccccccccccCEECccccEEEEEEccccccccEEEEECcccEEEEEEEEEEEEccccccccEEEEEEEEcccEEEEEEEcccccccccEEEEEEccEEEEEEccccccccccEEEEEcc
******DVAAAVNHLFDIPETMEKFTT**********KSKGVSSIPVDILDSPKDYIFFMDVPGRPKSDIQVTVEDERTL*****************CKCIRLERRVPQKLLRKFKLPEDANVSAISAKCENGVLTIVV***********VEVAIS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRVIDDVAAAVNHLFDIPETMEKFTTPSRSPHQETNKSKGVSSIPVDILDSPKDYIFFMDVPGRPKSDIQVTVEDERTLVIRSNGKRKREDGEEEGCKCIRLERRVPQKLLRKFKLPEDANVSAISAKCENGVLTIVVEKLPPPPKPKTVEVAIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
17.4 kDa class III heat shock protein probableQ9SYG1
18.6 kDa class III heat shock protein probableQ6K7E9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GME, chain A
Confidence level:very confident
Coverage over the Query: 41-154
View the alignment between query and template
View the model in PyMOL