Citrus Sinensis ID: 031606


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MGSRGLLLLKGAAPKHHIFNNTKGSIFSSKMPTRYYYYDYDYNNRTRNCSTTTTRSSLEPPDVPRLAQTARISLTPHEVEEFAPKIRQVIDWFGQLQDVDLDSVDPALRAGSKREKNTLCYYPRICAGGTSLIIQLFCLLSVRVYCKWNASGMLFQ
ccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHEEEEEcccccccc
****GLLLLKGAAPKHHIFNNTKGSIFSSKMPTRY*YY***********************DVPRLAQTARISLTPHEVEEFAPKIRQVIDWFGQLQDVDLDSVDPALRAGSKREKNTLCYYPRICAGGTSLIIQLFCLLSVRVYCKWNASGMLFQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSRGLLLLKGAAPKHHIFNNTKGSIFSSKMPTRYYYYDYDYNNRTRNCSTTTTRSSLEPPDVPRLAQTARISLTPHEVEEFAPKIRQVIDWFGQLQDVDLDSVDPALRAGSKREKNTLCYYPRICAGGTSLIIQLFCLLSVRVYCKWNASGMLFQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in chloroplasts and mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).probableD7STK2
Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in chloroplasts and mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).probableB9INH0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IP4, chain C
Confidence level:confident
Coverage over the Query: 57-136
View the alignment between query and template
View the model in PyMOL