Citrus Sinensis ID: 031613

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------

MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD

cEEEEEcccccEEEEEEcccccHHHHHHHHHHHcccccccEEEEEccEEccccccccccccccccEEEEEEEEccccEEcccEEcccccccHHHHHHEEEEEEcEEEEccccccEEEccccccccccccEEEcEEcccccccccEEEEEEEccccc

cEEEEEEccccEEEEEcccccEHHHHHHHHHHHHcccHHHEEEEEccEEcccccEcHHHccccccEEEEEEcccccccccccEEccccccccccEEEEEEEEEEEEEEcccccEcccccccccccccccEEEccccccccccccEEEEEEcccccc

MQIFVKTltgktitlevessdtiDNVKAKiqdkegippdqQRLIFAGkqledgrtladyniqkesTLHLVLRLRGgakkrkkktytkpkkikhkkkKVKLAVLQFykvddsgkVQRLrkecpnaecgagtfmanhfdrhycgkcgltYVYQKAGGD

mqifvktltgktitlevessdtidnVKAKIqdkegippdqqRLIFAGKQLEDGRTLAdyniqkestlhlvlrlrggakkrkkktytkpkkikhkkkkvklavlqfykvddsgkvqRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD

MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkkkkvkLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD

***FVKTLTGKTITLE**************************LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG********************KKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQ*****

MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK****

MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG**********************VKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD

MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		156	2.2.26 [Sep-21-2011]
P62981		156	Ubiquitin-40S ribosomal p	N/A	no	1.0	1.0	0.987	5e-86
P62980		156	Ubiquitin-40S ribosomal p	N/A	no	1.0	1.0	0.987	5e-86
P47905		155	Ubiquitin-40S ribosomal p	N/A	no	0.980	0.987	0.980	4e-83
P59232		157	Ubiquitin-40S ribosomal p	yes	no	0.993	0.987	0.961	2e-69
P59233		157	Ubiquitin-40S ribosomal p	yes	no	0.987	0.980	0.961	2e-69
P59271		156	Ubiquitin-40S ribosomal p	no	no	0.980	0.980	0.921	8e-69
Q9ARZ9		155	Ubiquitin-40S ribosomal p	yes	no	0.974	0.980	0.954	9e-68
P0CG87		155	Ubiquitin-40S ribosomal p	N/A	no	0.980	0.987	0.961	1e-67
P0CG86		155	Ubiquitin-40S ribosomal p	N/A	no	0.980	0.987	0.954	2e-67
P27923		155	Ubiquitin-40S ribosomal p	N/A	no	0.980	0.987	0.954	9e-67

>sp\|P62981\|RS27A_SOLTU Ubiquitin-40S ribosomal protein S27a OS=Solanum tuberosum GN=UBI3 PE=2 SV=2	Back alignment and function desciption

 Score =  315 bits (808), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 154/156 (98%), Positives = 155/156 (99%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 61  IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKE 120
           IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDD+GKVQRLRKE
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDTGKVQRLRKE 120

Query: 121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 156
           CPNAECGAGTFMANHFDRHYCGKCGLTYVY KAGGD
Sbjct: 121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGGD 156

Ribosomal protein S27a is a component of the 40S subunit of the ribosome.
Solanum tuberosum (taxid: 4113)

>sp\|P62980\|RS27A_SOLLC Ubiquitin-40S ribosomal protein S27a OS=Solanum lycopersicum GN=UBI3 PE=3 SV=2	Back alignment and function description

>sp\|P47905\|RS27A_LUPAL Ubiquitin-40S ribosomal protein S27a OS=Lupinus albus PE=3 SV=2	Back alignment and function description

>sp\|P59232\|R27AB_ARATH Ubiquitin-40S ribosomal protein S27a-2 OS=Arabidopsis thaliana GN=RPS27AB PE=1 SV=2	Back alignment and function description

>sp\|P59233\|R27AC_ARATH Ubiquitin-40S ribosomal protein S27a-3 OS=Arabidopsis thaliana GN=RPS27AC PE=1 SV=2	Back alignment and function description

>sp\|P59271\|R27AA_ARATH Ubiquitin-40S ribosomal protein S27a-1 OS=Arabidopsis thaliana GN=RPS27AA PE=1 SV=2	Back alignment and function description

>sp\|Q9ARZ9\|R27AA_ORYSJ Ubiquitin-40S ribosomal protein S27a-1 OS=Oryza sativa subsp. japonica GN=RPS27AA PE=2 SV=1	Back alignment and function description

>sp\|P0CG87\|RS272_HORVU Ubiquitin-40S ribosomal protein S27a OS=Hordeum vulgare GN=MUB2 PE=3 SV=1	Back alignment and function description

>sp\|P0CG86\|RS271_HORVU Ubiquitin-40S ribosomal protein S27a OS=Hordeum vulgare GN=MUB1 PE=3 SV=1	Back alignment and function description

>sp\|P27923\|RS27A_MAIZE Ubiquitin-40S ribosomal protein S27a OS=Zea mays GN=UBF9 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		156
224053300		156	predicted protein [Populus trichocarpa]	1.0	1.0	1.0	3e-85
126038342		156	ubiquitin extension protein [Hevea brasi	1.0	1.0	0.993	4e-85
225462644		156	PREDICTED: ubiquitin-40S ribosomal prote	1.0	1.0	0.993	5e-85
71913239		156	ubiquitin extension protein [Nicotiana t	1.0	1.0	0.993	5e-85
73761683		156	ubiquitin extension protein [Gossypium h	1.0	1.0	0.993	7e-85
225437695		156	PREDICTED: ubiquitin-40S ribosomal prote	1.0	1.0	0.993	7e-85
225439342		156	PREDICTED: ubiquitin-40S ribosomal prote	1.0	1.0	0.993	7e-85
224130892		156	predicted protein [Populus trichocarpa]	1.0	1.0	0.993	1e-84
386870487		156	ubiquitin extension protein 5 [Sesamum i	1.0	1.0	0.993	1e-84
147853527		156	hypothetical protein VITISV_036195 [Viti	1.0	1.0	0.993	1e-84

>gi|224053300|ref|XP_002297752.1| predicted protein [Populus trichocarpa] gi|224064701|ref|XP_002301539.1| predicted protein [Populus trichocarpa] gi|224114615|ref|XP_002332324.1| predicted protein [Populus trichocarpa] gi|224136388|ref|XP_002322317.1| predicted protein [Populus trichocarpa] gi|255548313|ref|XP_002515213.1| ubiquitin, putative [Ricinus communis] gi|1771780|emb|CAA71132.1| ubiquitin extension protein [Solanum tuberosum] gi|76573361|gb|ABA46785.1| ubiquitin extension protein-like protein [Solanum tuberosum] gi|118481233|gb|ABK92566.1| unknown [Populus trichocarpa] gi|118484030|gb|ABK93901.1| unknown [Populus trichocarpa] gi|118484734|gb|ABK94236.1| unknown [Populus trichocarpa] gi|118484740|gb|ABK94239.1| unknown [Populus trichocarpa] gi|118484834|gb|ABK94284.1| unknown [Populus trichocarpa] gi|196166892|gb|ACG70965.1| ubiquitin extensive-like protein [Ziziphus jujuba] gi|222832571|gb|EEE71048.1| predicted protein [Populus trichocarpa] gi|222843265|gb|EEE80812.1| predicted protein [Populus trichocarpa] gi|222845010|gb|EEE82557.1| predicted protein [Populus trichocarpa] gi|222869313|gb|EEF06444.1| predicted protein [Populus trichocarpa] gi|223545693|gb|EEF47197.1| ubiquitin, putative [Ricinus communis]

Back alignment and taxonomy information

 Score =  319 bits (817), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 61  IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKE 120
           IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKE
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKE 120

Query: 121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 156
           CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD
Sbjct: 121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 156

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|126038342\|gb\|ABN72579.1\| ubiquitin extension protein [Hevea brasiliensis]	Back alignment and taxonomy information

>gi\|225462644\|ref\|XP_002266750.1\| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 1 [Vitis vinifera] gi\|359491770\|ref\|XP_003634320.1\| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 2 [Vitis vinifera] gi\|147836392\|emb\|CAN75420.1\| hypothetical protein VITISV_037877 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|71913239\|gb\|AAZ53360.1\| ubiquitin extension protein [Nicotiana tabacum]	Back alignment and taxonomy information

>gi\|73761683\|gb\|AAZ83341.1\| ubiquitin extension protein [Gossypium hirsutum]	Back alignment and taxonomy information

>gi\|225437695\|ref\|XP_002279878.1\| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 1 [Vitis vinifera] gi\|359480213\|ref\|XP_003632417.1\| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 2 [Vitis vinifera] gi\|147767872\|emb\|CAN71283.1\| hypothetical protein VITISV_027093 [Vitis vinifera] gi\|147834215\|emb\|CAN70884.1\| hypothetical protein VITISV_029192 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225439342\|ref\|XP_002270170.1\| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 1 [Vitis vinifera] gi\|359481049\|ref\|XP_003632559.1\| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 2 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224130892\|ref\|XP_002320950.1\| predicted protein [Populus trichocarpa] gi\|118481566\|gb\|ABK92725.1\| unknown [Populus trichocarpa] gi\|222861723\|gb\|EEE99265.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|386870487\|gb\|AFJ42574.1\| ubiquitin extension protein 5 [Sesamum indicum]	Back alignment and taxonomy information

>gi\|147853527\|emb\|CAN80663.1\| hypothetical protein VITISV_036195 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		156
TAIR\|locus:2041459		157	UBQ6 "ubiquitin 6" [Arabidopsi	0.987	0.980	0.831	2.6e-63
TAIR\|locus:2098003		157	UBQ5 "ubiquitin 5" [Arabidopsi	0.987	0.980	0.824	3.3e-63
TAIR\|locus:2028005		156	AT1G23410 [Arabidopsis thalian	0.980	0.980	0.790	3.1e-60
UNIPROTKB\|P79781		156	RPS27A "Ubiquitin-40S ribosoma	0.974	0.974	0.736	1.6e-56
UNIPROTKB\|P62992		156	RPS27A "Ubiquitin-40S ribosoma	0.974	0.974	0.736	2e-56
UNIPROTKB\|F1PEZ4		156	RPS27A "Uncharacterized protei	0.974	0.974	0.736	2e-56
UNIPROTKB\|P62979		156	RPS27A "Ubiquitin-40S ribosoma	0.974	0.974	0.736	2e-56
UNIPROTKB\|F2Z5U0		156	RPS27A "Uncharacterized protei	0.974	0.974	0.736	2e-56
ZFIN\|ZDB-GENE-030131-10018		172	rps27a "ribosomal protein S27a	0.974	0.883	0.736	4.2e-56
MGI\|MGI:1925544		156	Rps27a "ribosomal protein S27A	0.974	0.974	0.730	5.3e-56

TAIR\|locus:2041459 UBQ6 "ubiquitin 6" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 646 (232.5 bits), Expect = 2.6e-63, P = 2.6e-63
 Identities = 128/154 (83%), Positives = 129/154 (83%)

Query:     1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct:     1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query:    61 IQKESTLHLVLRLRGGAXXXXXXXXXXXXXXXXXXXXXXLAVLQFYKVDDSGKVQRLRKE 120
             IQKESTLHLVLRLRGGA                      LAVLQFYKVD SGKVQRLRKE
Sbjct:    61 IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDGSGKVQRLRKE 120

Query:   121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAG 154
             CPNA CGAGTFMA+HFDRHYCGKCGLTYVYQK G
Sbjct:   121 CPNATCGAGTFMASHFDRHYCGKCGLTYVYQKEG 154

GO:0003735 "structural constituent of ribosome" evidence=IEA

GO:0005622 "intracellular" evidence=IEA;TAS

GO:0005840 "ribosome" evidence=IEA

GO:0006412 "translation" evidence=IEA

GO:0022627 "cytosolic small ribosomal subunit" evidence=IDA

GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=ISS

GO:0042787 "protein ubiquitination involved in ubiquitin-dependent protein catabolic process" evidence=ISS

GO:0005794 "Golgi apparatus" evidence=IDA

TAIR\|locus:2098003 UBQ5 "ubiquitin 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2028005 AT1G23410 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|P79781 RPS27A "Ubiquitin-40S ribosomal protein S27a" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|P62992 RPS27A "Ubiquitin-40S ribosomal protein S27a" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PEZ4 RPS27A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|P62979 RPS27A "Ubiquitin-40S ribosomal protein S27a" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

 Score = 581 (209.6 bits), Expect = 2.0e-56, P = 2.0e-56
 Identities = 112/152 (73%), Positives = 123/152 (80%)

Query:     1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60
             MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct:     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query:    61 IQKESTLHLVLRLRGGAXXXXXXXXXXXXXXXXXXXXXXLAVLQFYKVDDSGKVQRLRKE 120
             IQKESTLHLVLRLRGGA                      LAVL++YKVD++GK+ RLR+E
Sbjct:    61 IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE 120

Query:   121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152
             CP+ ECGAG FMA+HFDRHYCGKC LTY + K
Sbjct:   121 CPSDECGAGVFMASHFDRHYCGKCCLTYCFNK 152

GO:0046872 "metal ion binding" evidence=IEA

GO:0003735 "structural constituent of ribosome" evidence=IDA

GO:0022627 "cytosolic small ribosomal subunit" evidence=IDA

GO:0015935 "small ribosomal subunit" evidence=IDA

GO:0006412 "translation" evidence=IC;TAS

GO:0000075 "cell cycle checkpoint" evidence=TAS

GO:0000080 "G1 phase of mitotic cell cycle" evidence=TAS

GO:0000082 "G1/S transition of mitotic cell cycle" evidence=TAS

GO:0000084 "S phase of mitotic cell cycle" evidence=TAS

GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=TAS

GO:0000184 "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay" evidence=TAS

GO:0000187 "activation of MAPK activity" evidence=TAS

GO:0000209 "protein polyubiquitination" evidence=TAS

GO:0000216 "M/G1 transition of mitotic cell cycle" evidence=TAS

GO:0000278 "mitotic cell cycle" evidence=TAS

GO:0002224 "toll-like receptor signaling pathway" evidence=TAS

GO:0002474 "antigen processing and presentation of peptide antigen via MHC class I" evidence=TAS

GO:0002479 "antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent" evidence=TAS

GO:0002755 "MyD88-dependent toll-like receptor signaling pathway" evidence=TAS

GO:0002756 "MyD88-independent toll-like receptor signaling pathway" evidence=TAS

GO:0005654 "nucleoplasm" evidence=TAS

GO:0005829 "cytosol" evidence=TAS

GO:0005886 "plasma membrane" evidence=TAS

GO:0006281 "DNA repair" evidence=TAS

GO:0006351 "transcription, DNA-dependent" evidence=TAS

GO:0006367 "transcription initiation from RNA polymerase II promoter" evidence=TAS

GO:0006413 "translational initiation" evidence=TAS

GO:0006414 "translational elongation" evidence=TAS

GO:0006415 "translational termination" evidence=TAS

GO:0006614 "SRP-dependent cotranslational protein targeting to membrane" evidence=TAS

GO:0006915 "apoptotic process" evidence=TAS

GO:0006977 "DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest" evidence=TAS

GO:0007173 "epidermal growth factor receptor signaling pathway" evidence=TAS

GO:0007179 "transforming growth factor beta receptor signaling pathway" evidence=TAS

GO:0007219 "Notch signaling pathway" evidence=TAS

GO:0007220 "Notch receptor processing" evidence=TAS

GO:0007249 "I-kappaB kinase/NF-kappaB cascade" evidence=TAS

GO:0007254 "JNK cascade" evidence=TAS

GO:0008063 "Toll signaling pathway" evidence=TAS

GO:0008543 "fibroblast growth factor receptor signaling pathway" evidence=TAS

GO:0010008 "endosome membrane" evidence=TAS

GO:0010467 "gene expression" evidence=TAS

GO:0016032 "viral reproduction" evidence=TAS

GO:0016044 "cellular membrane organization" evidence=TAS

GO:0016070 "RNA metabolic process" evidence=TAS

GO:0016071 "mRNA metabolic process" evidence=TAS

GO:0016197 "endosomal transport" evidence=TAS

GO:0019058 "viral infectious cycle" evidence=TAS

GO:0019083 "viral transcription" evidence=TAS

GO:0019221 "cytokine-mediated signaling pathway" evidence=TAS

GO:0030512 "negative regulation of transforming growth factor beta receptor signaling pathway" evidence=TAS

GO:0030666 "endocytic vesicle membrane" evidence=TAS

GO:0031145 "anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process" evidence=TAS

GO:0032480 "negative regulation of type I interferon production" evidence=TAS

GO:0033554 "cellular response to stress" evidence=TAS

GO:0034130 "toll-like receptor 1 signaling pathway" evidence=TAS

GO:0034134 "toll-like receptor 2 signaling pathway" evidence=TAS

GO:0034138 "toll-like receptor 3 signaling pathway" evidence=TAS

GO:0034142 "toll-like receptor 4 signaling pathway" evidence=TAS

GO:0035666 "TRIF-dependent toll-like receptor signaling pathway" evidence=TAS

GO:0035872 "nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway" evidence=TAS

GO:0042059 "negative regulation of epidermal growth factor receptor signaling pathway" evidence=TAS

GO:0042590 "antigen processing and presentation of exogenous peptide antigen via MHC class I" evidence=TAS

GO:0042981 "regulation of apoptotic process" evidence=TAS

GO:0043123 "positive regulation of I-kappaB kinase/NF-kappaB cascade" evidence=TAS

GO:0044267 "cellular protein metabolic process" evidence=TAS

GO:0045087 "innate immune response" evidence=TAS

GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=TAS

GO:0046788 "egress of virus within host cell" evidence=TAS

GO:0048011 "neurotrophin TRK receptor signaling pathway" evidence=TAS

GO:0050852 "T cell receptor signaling pathway" evidence=TAS

GO:0051092 "positive regulation of NF-kappaB transcription factor activity" evidence=TAS

GO:0051403 "stress-activated MAPK cascade" evidence=TAS

GO:0051436 "negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle" evidence=TAS

GO:0051437 "positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle" evidence=TAS

GO:0051439 "regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle" evidence=TAS

GO:0061418 "regulation of transcription from RNA polymerase II promoter in response to hypoxia" evidence=TAS

GO:0070423 "nucleotide-binding oligomerization domain containing signaling pathway" evidence=TAS

GO:0071456 "cellular response to hypoxia" evidence=TAS

UNIPROTKB\|F2Z5U0 RPS27A "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-10018 rps27a "ribosomal protein S27a" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:1925544 Rps27a "ribosomal protein S27A" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P0CG83	UBIQP_HORVU	No assigned EC number	0.9743	0.5	0.4561	N/A	no
P0CG84	UBI4P_NICSY	No assigned EC number	0.9743	0.5	0.2068	N/A	no
P0CG85	UBI1P_NICSY	No assigned EC number	0.9743	0.5	0.1706	N/A	no
P0CG86	RS271_HORVU	No assigned EC number	0.9548	0.9807	0.9870	N/A	no
P0CG87	RS272_HORVU	No assigned EC number	0.9612	0.9807	0.9870	N/A	no
P68202	RS27A_PLUXY	No assigned EC number	0.8344	0.9679	0.9741	N/A	no
P68203	RS27A_SPOFR	No assigned EC number	0.8344	0.9679	0.9679	N/A	no
P62978	RS27A_CAVPO	No assigned EC number	0.8552	0.9743	0.9743	yes	no
P62979	RS27A_HUMAN	No assigned EC number	0.8552	0.9743	0.9743	yes	no
P69322	UBIQP_PEA	No assigned EC number	0.9743	0.5	0.2047	N/A	no
P14799	RS27A_NEUCR	No assigned EC number	0.8246	0.9871	1.0	N/A	no
P69310	UBIQ_AVESA	No assigned EC number	1.0	0.4871	1.0	N/A	no
P05759	RS27A_YEAST	No assigned EC number	0.8445	0.9487	0.9736	yes	no
P14797	RS27A_DICDI	No assigned EC number	0.76	0.9551	0.9675	yes	no
P62992	RS27A_BOVIN	No assigned EC number	0.8552	0.9743	0.9743	yes	no
P69315	UBIQP_LINUS	No assigned EC number	0.9743	0.5	0.2557	N/A	no
P0CH05	UBI2P_PETCR	No assigned EC number	0.9743	0.5	0.1703	N/A	no
P0CH04	UBI1P_PETCR	No assigned EC number	0.9743	0.5	0.1703	N/A	no
P0C8R3	RS27B_SCHPO	No assigned EC number	0.8639	0.9294	0.9666	yes	no
P51431	R27AB_ORYSJ	No assigned EC number	0.9548	0.9807	0.9870	yes	no
P68200	RS27A_ICTPU	No assigned EC number	0.8552	0.9743	0.9743	N/A	no
P29504	RS27A_MANSE	No assigned EC number	0.8344	0.9679	0.9741	N/A	no
P47905	RS27A_LUPAL	No assigned EC number	0.9803	0.9807	0.9870	N/A	no
P31753	RS27A_ASPOF	No assigned EC number	0.9658	0.75	0.9915	N/A	no
P69309	UBIQP_AVEFA	No assigned EC number	0.9743	0.5	0.2557	N/A	no
P27923	RS27A_MAIZE	No assigned EC number	0.9548	0.9807	0.9870	N/A	no
P79781	RS27A_CHICK	No assigned EC number	0.8552	0.9743	0.9743	yes	no
P69061	RS27A_KLULA	No assigned EC number	0.8421	0.9615	1.0	yes	no
Q9ARZ9	R27AA_ORYSJ	No assigned EC number	0.9542	0.9743	0.9806	yes	no
P69326	UBIQ_WHEAT	No assigned EC number	1.0	0.4871	0.9870	N/A	no
P59272	RS27A_DAUCA	No assigned EC number	0.9580	0.9166	1.0	N/A	no
P59271	R27AA_ARATH	No assigned EC number	0.9215	0.9807	0.9807	no	no
P15357	RS27A_DROME	No assigned EC number	0.8421	0.9743	0.9743	yes	no
P62983	RS27A_MOUSE	No assigned EC number	0.8486	0.9743	0.9743	yes	no
P62982	RS27A_RAT	No assigned EC number	0.8486	0.9743	0.9743	yes	no
P62981	RS27A_SOLTU	No assigned EC number	0.9871	1.0	1.0	N/A	no
P62980	RS27A_SOLLC	No assigned EC number	0.9871	1.0	1.0	N/A	no
P51423	RL40_BRARA	No assigned EC number	1.0	0.4871	0.5937	N/A	no
P59233	R27AC_ARATH	No assigned EC number	0.9610	0.9871	0.9808	yes	no
P59232	R27AB_ARATH	No assigned EC number	0.9612	0.9935	0.9872	yes	no
P0C016	RS27A_SCHPO	No assigned EC number	0.8639	0.9294	0.9666	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	eugene3.00010275	SubName- Full=Putative uncharacterized protein; (156 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	fgenesh4_pg.C_scaffold_844000001	hypothetical protein (300 aa)	•	0.455

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		156
cd01803		76	cd01803, Ubiquitin, Ubiquitin	9e-51
smart00213		72	smart00213, UBQ, Ubiquitin homologues	7e-32
pfam00240		69	pfam00240, ubiquitin, Ubiquitin family	2e-31
cd01806		76	cd01806, Nedd8, Nebb8-like ubiquitin protein	2e-29
cd01769		69	cd01769, UBL, Ubiquitin-like domain of UBL	4e-27
pfam01599		47	pfam01599, Ribosomal_S27, Ribosomal protein S27a	2e-25
PTZ00044		76	PTZ00044, PTZ00044, ubiquitin; Provisional	4e-24
cd01802		103	cd01802, AN1_N, ubiquitin-like domain of AN1	6e-20
pfam11976		72	pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO-	6e-20
cd01805		77	cd01805, RAD23_N, Ubiquitin-like domain of RAD23	9e-16
cd01793		74	cd01793, Fubi, Fubi ubiquitin-like protein	2e-15
cd01809		72	cd01809, Scythe_N, Ubiquitin-like domain of Scythe	2e-15
COG1998		51	COG1998, RPS31, Ribosomal protein S27AE [Translati	2e-15
cd00196		69	cd00196, UBQ, Ubiquitin-like proteins	1e-14
cd01798		70	cd01798, parkin_N, amino-terminal ubiquitin-like o	2e-14
cd01807		74	cd01807, GDX_N, ubiquitin-like domain of GDX	5e-13
cd01800		76	cd01800, SF3a120_C, Ubiquitin-like domain of Mamma	1e-12
cd01797		78	cd01797, NIRF_N, amino-terminal ubiquitin-like dom	2e-12
TIGR00601		378	TIGR00601, rad23, UV excision repair protein Rad23	3e-11
cd01810		74	cd01810, ISG15_repeat2, ISG15 ubiquitin-like prote	1e-10
COG5272		57	COG5272, UBI4, Ubiquitin [Posttranslational modifi	9e-10
PRK00432		50	PRK00432, PRK00432, 30S ribosomal protein S27ae; V	1e-09
cd01794		70	cd01794, DC_UbP_C, dendritic cell derived ubiquiti	4e-07
cd01796		71	cd01796, DDI1_N, DNA damage inducible protein 1 ub	5e-07
pfam13881		111	pfam13881, Rad60-SLD_2, Ubiquitin-2 like Rad60 SUM	2e-06
cd01812		71	cd01812, BAG1_N, Ubiquitin-like domain of BAG1	3e-06
cd01808		71	cd01808, hPLIC_N, Ubiquitin-like domain of hPLIC-1	3e-06
cd01792		80	cd01792, ISG15_repeat1, ISG15 ubiquitin-like prote	6e-06
cd01804		78	cd01804, midnolin_N, Ubiquitin-like domain of midn	7e-05
cd01799		75	cd01799, Hoil1_N, Ubiquitin-like domain of HOIL1	8e-04
pfam13019		163	pfam13019, Telomere_Sde2, Telomere stability and s	0.001

>gnl\|CDD\|176398 cd01803, Ubiquitin, Ubiquitin	Back alignment and domain information

 Score =  156 bits (396), Expect = 9e-51
 Identities = 73/76 (96%), Positives = 75/76 (98%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60
          MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct: 1  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

Ubiquitin (includes Ubq/RPL40e and Ubq/RPS27a fusions as well as homopolymeric multiubiquitin protein chains). Length = 76

>gnl\|CDD\|214563 smart00213, UBQ, Ubiquitin homologues	Back alignment and domain information

>gnl\|CDD\|215813 pfam00240, ubiquitin, Ubiquitin family	Back alignment and domain information

>gnl\|CDD\|176401 cd01806, Nedd8, Nebb8-like ubiquitin protein	Back alignment and domain information

>gnl\|CDD\|176364 cd01769, UBL, Ubiquitin-like domain of UBL	Back alignment and domain information

>gnl\|CDD\|110592 pfam01599, Ribosomal_S27, Ribosomal protein S27a	Back alignment and domain information

>gnl\|CDD\|185411 PTZ00044, PTZ00044, ubiquitin; Provisional	Back alignment and domain information

>gnl\|CDD\|176397 cd01802, AN1_N, ubiquitin-like domain of AN1	Back alignment and domain information

>gnl\|CDD\|192903 pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO-like	Back alignment and domain information

>gnl\|CDD\|176400 cd01805, RAD23_N, Ubiquitin-like domain of RAD23	Back alignment and domain information

>gnl\|CDD\|176388 cd01793, Fubi, Fubi ubiquitin-like protein	Back alignment and domain information

>gnl\|CDD\|176404 cd01809, Scythe_N, Ubiquitin-like domain of Scythe protein	Back alignment and domain information

>gnl\|CDD\|224909 COG1998, RPS31, Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|176352 cd00196, UBQ, Ubiquitin-like proteins	Back alignment and domain information

>gnl\|CDD\|176393 cd01798, parkin_N, amino-terminal ubiquitin-like of parkin protein	Back alignment and domain information

>gnl\|CDD\|176402 cd01807, GDX_N, ubiquitin-like domain of GDX	Back alignment and domain information

>gnl\|CDD\|176395 cd01800, SF3a120_C, Ubiquitin-like domain of Mammalian splicing factor SF3a_120	Back alignment and domain information

>gnl\|CDD\|176392 cd01797, NIRF_N, amino-terminal ubiquitin-like domain of Np95 and NIRF	Back alignment and domain information

>gnl\|CDD\|233045 TIGR00601, rad23, UV excision repair protein Rad23	Back alignment and domain information

>gnl\|CDD\|176405 cd01810, ISG15_repeat2, ISG15 ubiquitin-like protein, second repeat of 2	Back alignment and domain information

>gnl\|CDD\|227597 COG5272, UBI4, Ubiquitin [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|234760 PRK00432, PRK00432, 30S ribosomal protein S27ae; Validated	Back alignment and domain information

>gnl\|CDD\|176389 cd01794, DC_UbP_C, dendritic cell derived ubiquitin-like protein	Back alignment and domain information

>gnl\|CDD\|176391 cd01796, DDI1_N, DNA damage inducible protein 1 ubiquitin-like domain	Back alignment and domain information

>gnl\|CDD\|206052 pfam13881, Rad60-SLD_2, Ubiquitin-2 like Rad60 SUMO-like	Back alignment and domain information

>gnl\|CDD\|176407 cd01812, BAG1_N, Ubiquitin-like domain of BAG1	Back alignment and domain information

>gnl\|CDD\|176403 cd01808, hPLIC_N, Ubiquitin-like domain of hPLIC-1 and hPLIC2	Back alignment and domain information

>gnl\|CDD\|176387 cd01792, ISG15_repeat1, ISG15 ubiquitin-like protein, first repeat of 2	Back alignment and domain information

>gnl\|CDD\|176399 cd01804, midnolin_N, Ubiquitin-like domain of midnolin	Back alignment and domain information

>gnl\|CDD\|176394 cd01799, Hoil1_N, Ubiquitin-like domain of HOIL1	Back alignment and domain information

>gnl\|CDD\|205200 pfam13019, Telomere_Sde2, Telomere stability and silencing	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		156
KOG0004		156	consensus Ubiquitin/40S ribosomal protein S27a fus	100.0
PF01599		47	Ribosomal_S27: Ribosomal protein S27a; InterPro: I	99.96
COG1998		51	RPS31 Ribosomal protein S27AE [Translation, riboso	99.93
cd01793		74	Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui	99.88
PTZ00044		76	ubiquitin; Provisional	99.87
cd01807		74	GDX_N ubiquitin-like domain of GDX. GDX contains a	99.86
cd01802		103	AN1_N ubiquitin-like domain of AN1. AN1 (also know	99.86
cd01803		76	Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40	99.86
cd01806		76	Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn	99.85
cd01810		74	ISG15_repeat2 ISG15 ubiquitin-like protein, second	99.84
cd01804		78	midnolin_N Ubiquitin-like domain of midnolin. midn	99.83
cd01797		78	NIRF_N amino-terminal ubiquitin-like domain of Np9	99.83
cd01791		73	Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know	99.81
cd01805		77	RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo	99.81
cd01800		76	SF3a120_C Ubiquitin-like domain of Mammalian splic	99.8
cd01809		72	Scythe_N Ubiquitin-like domain of Scythe protein.	99.8
cd01794		70	DC_UbP_C dendritic cell derived ubiquitin-like pro	99.79
cd01798		70	parkin_N amino-terminal ubiquitin-like of parkin p	99.79
cd01792		80	ISG15_repeat1 ISG15 ubiquitin-like protein, first	99.78
cd01808		71	hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC	99.77
KOG0003		128	consensus Ubiquitin/60s ribosomal protein L40 fusi	99.76
PF00240		69	ubiquitin: Ubiquitin family; InterPro: IPR000626 U	99.76
cd01796		71	DDI1_N DNA damage inducible protein 1 ubiquitin-li	99.73
cd01763		87	Sumo Small ubiquitin-related modifier (SUMO). Smal	99.73
cd01812		71	BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter	99.72
PRK00432		50	30S ribosomal protein S27ae; Validated	99.71
cd01790		79	Herp_N Homocysteine-responsive endoplasmic reticul	99.7
cd01813		74	UBP_N UBP ubiquitin processing protease. The UBP (	99.69
KOG0005		70	consensus Ubiquitin-like protein [Cell cycle contr	99.68
smart00213		64	UBQ Ubiquitin homologues. Ubiquitin-mediated prote	99.64
cd01814		113	NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT	99.62
TIGR00601		378	rad23 UV excision repair protein Rad23. All protei	99.58
cd01799		75	Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO	99.56
cd01815		75	BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC	99.53
cd01769		69	UBL Ubiquitin-like domain of UBL. UBLs function by	99.5
PF11976		72	Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter	99.45
cd01795		107	USP48_C USP ubiquitin-specific protease. The USP (	99.44
KOG0010		493	consensus Ubiquitin-like protein [Posttranslationa	99.41
KOG0011		340	consensus Nucleotide excision repair factor NEF2,	99.32
cd01789		84	Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol	99.31
PF14560		87	Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K	99.22
PF13881		111	Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB	99.16
KOG0001		75	consensus Ubiquitin and ubiquitin-like proteins [P	99.16
cd01788		119	ElonginB Ubiquitin-like domain of Elongin B. Elong	99.15
PLN02560		308	enoyl-CoA reductase	99.13
cd01801		77	Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N-	98.94
PF11543		80	UN_NPL4: Nuclear pore localisation protein NPL4; I	98.91
KOG4248		1143	consensus Ubiquitin-like protein, regulator of apo	98.91
cd00196		69	UBQ Ubiquitin-like proteins. Ubiquitin homologs; I	98.76
KOG1769		99	consensus Ubiquitin-like proteins [Posttranslation	98.54
cd01811		80	OASL_repeat1 2'-5' oligoadenylate synthetase-like	98.49
KOG0006		446	consensus E3 ubiquitin-protein ligase (Parkin prot	98.46
PF13019		162	Telomere_Sde2: Telomere stability and silencing	98.33
KOG3493		73	consensus Ubiquitin-like protein [Posttranslationa	98.27
KOG1872		473	consensus Ubiquitin-specific protease [Posttransla	98.27
KOG4495		110	consensus RNA polymerase II transcription elongati	98.22
PF08817		79	YukD: WXG100 protein secretion system (Wss), prote	97.98
PF00789		82	UBX: UBX domain; InterPro: IPR001012 The UBX domai	97.96
PF11470		65	TUG-UBL1: GLUT4 regulating protein TUG; InterPro:	97.9
smart00166		80	UBX Domain present in ubiquitin-regulatory protein	97.82
COG5227		103	SMT3 Ubiquitin-like protein (sentrin) [Posttransla	97.77
cd01772		79	SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst	97.66
PF10302		97	DUF2407: DUF2407 ubiquitin-like domain; InterPro:	97.63
cd01767		77	UBX UBX (ubiquitin regulatory X) domain. The UBX (	97.52
cd01770		79	p47_UBX p47-like ubiquitin domain. p47_UBX p47 is	97.48
cd01773		82	Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i	97.44
cd01771		80	Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac	97.3
cd01774		85	Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i	97.26
KOG0013		231	consensus Uncharacterized conserved protein [Funct	97.26
KOG1639		297	consensus Steroid reductase required for elongatio	97.0
COG5417		81	Uncharacterized small protein [Function unknown]	97.0
KOG3206		234	consensus Alpha-tubulin folding cofactor B [Posttr	96.94
PRK06437		67	hypothetical protein; Provisional	96.62
PRK06488		65	sulfur carrier protein ThiS; Validated	96.53
PLN02799		82	Molybdopterin synthase sulfur carrier subunit	96.37
PRK08364		70	sulfur carrier protein ThiS; Provisional	96.18
PF12754		309	Blt1: Cell-cycle control medial ring component; In	96.11
cd00754		80	MoaD Ubiquitin domain of MoaD-like proteins. MoaD	96.04
KOG4583		391	consensus Membrane-associated ER protein involved	96.01
PF15044		76	CLU_N: Mitochondrial function, CLU-N-term	95.96
cd06409		86	PB1_MUG70 The MUG70 protein is a product of the me	95.74
PRK05863		65	sulfur carrier protein ThiS; Provisional	95.6
cd06406		80	PB1_P67 A PB1 domain is present in p67 proteins wh	95.57
PF09379		80	FERM_N: FERM N-terminal domain ; InterPro: IPR0189	95.55
PRK08053		66	sulfur carrier protein ThiS; Provisional	95.52
PF11620		88	GABP-alpha: GA-binding protein alpha chain; InterP	95.49
PRK05659		66	sulfur carrier protein ThiS; Validated	95.41
PHA00626		59	hypothetical protein	95.35
PF10790		76	DUF2604: Protein of Unknown function (DUF2604); In	95.12
COG5100		571	NPL4 Nuclear pore protein [Nuclear structure]	94.99
TIGR01682		80	moaD molybdopterin converting factor, subunit 1, n	94.99
cd00565		65	ThiS ThiaminS ubiquitin-like sulfur carrier protei	94.98
PF14836		88	Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A	94.82
TIGR01687		88	moaD_arch MoaD family protein, archaeal. Members o	94.79
PRK06944		65	sulfur carrier protein ThiS; Provisional	94.67
PF02597		77	ThiS: ThiS family; InterPro: IPR003749 ThiS (thiam	94.66
PRK07696		67	sulfur carrier protein ThiS; Provisional	94.55
cd06407		82	PB1_NLP A PB1 domain is present in NIN like protei	94.39
TIGR01683		64	thiS thiamine biosynthesis protein ThiS. This mode	94.36
PRK06083		84	sulfur carrier protein ThiS; Provisional	94.33
PF14453		57	ThiS-like: ThiS-like ubiquitin	94.28
KOG0012		380	consensus DNA damage inducible protein [Replicatio	94.14
PRK07440		70	hypothetical protein; Provisional	94.09
PF09855		64	DUF2082: Nucleic-acid-binding protein containing Z	93.8
smart00666		81	PB1 PB1 domain. Phox and Bem1p domain, present in	93.76
smart00295		207	B41 Band 4.1 homologues. Also known as ezrin/radix	92.71
KOG2086		380	consensus Protein tyrosine phosphatase SHP1/Cofact	91.96
PF10571		26	UPF0547: Uncharacterised protein family UPF0547; I	91.89
cd01760		72	RBD Ubiquitin-like domain of RBD-like S/T kinases.	91.74
KOG2689		290	consensus Predicted ubiquitin regulatory protein [	91.74
cd06408		86	PB1_NoxR The PB1 domain is present in the Epichloe	91.68
TIGR02958		452	sec_mycoba_snm4 secretion protein snm4. Members of	91.44
COG2104		68	ThiS Sulfur transfer protein involved in thiamine	91.43
smart00647		64	IBR In Between Ring fingers. the domains occurs be	91.26
KOG0009		62	consensus Ubiquitin-like/40S ribosomal S30 protein	90.97
smart00455		70	RBD Raf-like Ras-binding domain.	90.73
PRK11840		326	bifunctional sulfur carrier protein/thiazole synth	90.59
PF01485		64	IBR: IBR domain; InterPro: IPR002867 Zinc finger (	90.5
PF00564		84	PB1: PB1 domain; InterPro: IPR000270 The Phox and	90.49
COG2051		67	RPS27A Ribosomal protein S27E [Translation, riboso	90.26
COG1997		89	RPL43A Ribosomal protein L37AE/L43A [Translation,	90.18
PF01780		90	Ribosomal_L37ae: Ribosomal L37ae protein family; I	89.84
PRK05978		148	hypothetical protein; Provisional	89.58
smart00661		52	RPOL9 RNA polymerase subunit 9.	89.46
COG1645		131	Uncharacterized Zn-finger containing protein [Gene	89.46
PRK11130		81	moaD molybdopterin synthase small subunit; Provisi	89.38
cd05992		81	PB1 The PB1 domain is a modular domain mediating s	88.64
PRK00398		46	rpoP DNA-directed RNA polymerase subunit P; Provis	88.61
PF02196		71	RBD: Raf-like Ras-binding domain; InterPro: IPR003	88.61
cd06411		78	PB1_p51 The PB1 domain is present in the p51 prote	87.85
TIGR02098		38	MJ0042_CXXC MJ0042 family finger-like domain. This	87.72
PF01907		55	Ribosomal_L37e: Ribosomal protein L37e; InterPro:	87.13
cd06398		91	PB1_Joka2 The PB1 domain is present in the Nicotia	86.95
cd06396		81	PB1_NBR1 The PB1 domain is an essential part of NB	86.7
COG1096		188	Predicted RNA-binding protein (consists of S1 doma	86.56
TIGR00280		91	L37a ribosomal protein L37a. This model finds euka	86.3
PRK01777		95	hypothetical protein; Validated	85.82
cd06410		97	PB1_UP2 Uncharacterized protein 2. The PB1 domain	85.44
PTZ00380		121	microtubule-associated protein (MAP); Provisional	85.33
PF08825		84	E2_bind: E2 binding domain; InterPro: IPR014929 E1	85.32
PRK03976		90	rpl37ae 50S ribosomal protein L37Ae; Reviewed	85.2
KOG4250		732	consensus TANK binding protein kinase TBK1 [Signal	84.78
PRK09710		64	lar restriction alleviation and modification prote	84.51
cd01766		82	Ufm1 Urm1-like ubiquitin domain. Ufm1 (ubiquitin-f	84.03
cd01787		85	GRB7_RA RA (RAS-associated like) domain of Grb7. G	83.86
PTZ00255		90	60S ribosomal protein L37a; Provisional	83.75
PF04758		59	Ribosomal_S30: Ribosomal protein S30; InterPro: IP	83.49
PF13248		26	zf-ribbon_3: zinc-ribbon domain	83.16
cd01764		94	Urm1 Urm1-like ubuitin domain. Urm1 (Ubiquitin-Rel	82.94
PF02150		35	RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I	82.71
COG1571		421	Predicted DNA-binding protein containing a Zn-ribb	82.54
smart00154		39	ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C	82.33
COG5349		126	Uncharacterized protein conserved in bacteria [Fun	82.13
smart00144		108	PI3K_rbd PI3-kinase family, Ras-binding domain. Ce	81.95
PF10209		122	DUF2340: Uncharacterized conserved protein (DUF234	81.93
PF13719		37	zinc_ribbon_5: zinc-ribbon domain	81.92
PF08792		33	A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I	81.9
PF09538		108	FYDLN_acid: Protein of unknown function (FYDLN_aci	81.46
PRK09336		50	30S ribosomal protein S30e; Provisional	81.33
PF14803		34	Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C.	80.79
PF00788		93	RA: Ras association (RalGDS/AF-6) domain; InterPro	80.73
KOG2507		506	consensus Ubiquitin regulatory protein UBXD2, cont	80.43
PF02017		78	CIDE-N: CIDE-N domain; InterPro: IPR003508 This do	80.37

>KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

Probab=100.00  E-value=7.3e-49  Score=283.24  Aligned_cols=155  Identities=86%  Similarity=1.310  Sum_probs=152.2

Q ss_pred             CEEEEEeCCCCEEEEEecCCCcHHHHHHHHHHHhCCCCCceEEecCCeeccCCCcccccccCCCCEEEEEEeecCCcccc
Q 031613            1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKR   80 (156)
Q Consensus         1 M~I~Vk~~~g~~~~l~V~~~~TV~~LK~~I~~~~gip~~~qrL~~~G~~L~d~~tL~~~gi~~~stI~l~~~~~gg~~k~   80 (156)
                      |+|+|+.+.++++.++|.+++||..+|+.|++.+|||+++|||+|.|++|+|..+|+||+|+..++|+|+++++||++++
T Consensus         1 m~ifVk~l~~kti~~eve~~~ti~~~Kakiq~~egIp~dqqrlifag~qLedgrtlSDY~Iqkestl~l~l~l~Gg~kkr   80 (156)
T KOG0004|consen    1 MQIFVKTLTGKTITLEVEANDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKR   80 (156)
T ss_pred             CccchhhccccceeeeecccccHHHHHHhhhcccCCCchhhhhhhhhcccccCCccccccccccceEEEEEEecCCcccc
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccCCcccccccceeeeeEeeeEEEcCCCeEEEeeccCCCCccCCceEEeEeCCCCccCCceeEEEeecCCC
Q 031613           81 KKKTYTKPKKIKHKKKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGG  155 (156)
Q Consensus        81 ~kk~~~~pk~~k~~~kk~k~~~l~~y~vd~~g~~~~~~~~cp~~~c~~g~fma~h~~r~~cg~c~~t~~~~~~~~  155 (156)
                      +++.|++|+++++.++++++++++||++|+||+|++++++||++.|++|||||.|++|+|||+|.+|+.++.+.+
T Consensus        81 kkk~~~~pk~~~~~~kk~~l~~~~y~kvd~ngkiq~l~~~~~~~~~~~~v~~a~~~~r~y~gkc~~~~~~~~~~~  155 (156)
T KOG0004|consen   81 KKKSYTTPKKIKSKHKKVSLAVLKYYKVDENGKVQRLRRECPNPACGAGVFMASHADRHYCGKCLLTYKFKKAGG  155 (156)
T ss_pred             cccccccccccCCCccccccCCccceeeccCcchhhhhhhcCCcccccceecccccccccccccceeehhhhccC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999988764

>PF01599 Ribosomal_S27: Ribosomal protein S27a; InterPro: IPR002906 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd01793 Fubi Fubi ubiquitin-like protein	Back alignment and domain information

>PTZ00044 ubiquitin; Provisional	Back alignment and domain information

>cd01807 GDX_N ubiquitin-like domain of GDX	Back alignment and domain information

>cd01802 AN1_N ubiquitin-like domain of AN1	Back alignment and domain information

>cd01803 Ubiquitin Ubiquitin	Back alignment and domain information

>cd01806 Nedd8 Nebb8-like ubiquitin protein	Back alignment and domain information

>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2	Back alignment and domain information

>cd01804 midnolin_N Ubiquitin-like domain of midnolin	Back alignment and domain information

>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF	Back alignment and domain information

>cd01791 Ubl5 UBL5 ubiquitin-like modifier	Back alignment and domain information

>cd01805 RAD23_N Ubiquitin-like domain of RAD23	Back alignment and domain information

>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120	Back alignment and domain information

>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein	Back alignment and domain information

>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein	Back alignment and domain information

>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein	Back alignment and domain information

>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2	Back alignment and domain information

>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2	Back alignment and domain information

>KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade	Back alignment and domain information

>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain	Back alignment and domain information

>cd01763 Sumo Small ubiquitin-related modifier (SUMO)	Back alignment and domain information

>cd01812 BAG1_N Ubiquitin-like domain of BAG1	Back alignment and domain information

>PRK00432 30S ribosomal protein S27ae; Validated	Back alignment and domain information

>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein	Back alignment and domain information

>cd01813 UBP_N UBP ubiquitin processing protease	Back alignment and domain information

>KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00213 UBQ Ubiquitin homologues	Back alignment and domain information

>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4	Back alignment and domain information

>TIGR00601 rad23 UV excision repair protein Rad23	Back alignment and domain information

>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1	Back alignment and domain information

>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP	Back alignment and domain information

>cd01769 UBL Ubiquitin-like domain of UBL	Back alignment and domain information

>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins	Back alignment and domain information

>cd01795 USP48_C USP ubiquitin-specific protease	Back alignment and domain information

>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only]	Back alignment and domain information

>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair]	Back alignment and domain information

>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B	Back alignment and domain information

>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A	Back alignment and domain information

>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A	Back alignment and domain information

>KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only]	Back alignment and domain information

>cd01788 ElonginB Ubiquitin-like domain of Elongin B	Back alignment and domain information

>PLN02560 enoyl-CoA reductase	Back alignment and domain information

>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13	Back alignment and domain information

>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway	Back alignment and domain information

>KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00196 UBQ Ubiquitin-like proteins	Back alignment and domain information

>KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2	Back alignment and domain information

>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13019 Telomere_Sde2: Telomere stability and silencing	Back alignment and domain information

>KOG3493 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4495 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B [Transcription]	Back alignment and domain information

>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold []	Back alignment and domain information

>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast	Back alignment and domain information

>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly	Back alignment and domain information

>smart00166 UBX Domain present in ubiquitin-regulatory proteins	Back alignment and domain information

>COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01772 SAKS1_UBX SAKS1-like UBX domain	Back alignment and domain information

>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi	Back alignment and domain information

>cd01767 UBX UBX (ubiquitin regulatory X) domain	Back alignment and domain information

>cd01770 p47_UBX p47-like ubiquitin domain	Back alignment and domain information

>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain	Back alignment and domain information

>cd01771 Faf1_UBX Faf1 UBX domain	Back alignment and domain information

>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain	Back alignment and domain information

>KOG0013 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1639 consensus Steroid reductase required for elongation of the very long chain fatty acids [Lipid transport and metabolism]	Back alignment and domain information

>COG5417 Uncharacterized small protein [Function unknown]	Back alignment and domain information

>KOG3206 consensus Alpha-tubulin folding cofactor B [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06437 hypothetical protein; Provisional	Back alignment and domain information

>PRK06488 sulfur carrier protein ThiS; Validated	Back alignment and domain information

>PLN02799 Molybdopterin synthase sulfur carrier subunit	Back alignment and domain information

>PRK08364 sulfur carrier protein ThiS; Provisional	Back alignment and domain information

>PF12754 Blt1: Cell-cycle control medial ring component; InterPro: IPR024737 During size-dependent cell cycle transitions controlled by the ubiquitous cyclin-dependent kinase Cdk1, Blt1 has been shown to co-localise with Cdr2 in the medial interphase nodes, as well as with Mid1 which was previously shown to localise to similar interphase structures	Back alignment and domain information

>cd00754 MoaD Ubiquitin domain of MoaD-like proteins	Back alignment and domain information

>KOG4583 consensus Membrane-associated ER protein involved in stress response (contains ubiquitin-like domain) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF15044 CLU_N: Mitochondrial function, CLU-N-term	Back alignment and domain information

>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain	Back alignment and domain information

>PRK05863 sulfur carrier protein ThiS; Provisional	Back alignment and domain information

>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis	Back alignment and domain information

>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain	Back alignment and domain information

>PRK08053 sulfur carrier protein ThiS; Provisional	Back alignment and domain information

>PF11620 GABP-alpha: GA-binding protein alpha chain; InterPro: IPR024668 GA-binding protein alpha is a transcription factor capable of interacting with purine rich repeats (GA repeats)	Back alignment and domain information

>PRK05659 sulfur carrier protein ThiS; Validated	Back alignment and domain information

>PHA00626 hypothetical protein	Back alignment and domain information

>PF10790 DUF2604: Protein of Unknown function (DUF2604); InterPro: IPR019726 This entry represents bacterial proteins with undetermined function	Back alignment and domain information

>COG5100 NPL4 Nuclear pore protein [Nuclear structure]	Back alignment and domain information

>TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal	Back alignment and domain information

>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein	Back alignment and domain information

>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A	Back alignment and domain information

>TIGR01687 moaD_arch MoaD family protein, archaeal	Back alignment and domain information

>PRK06944 sulfur carrier protein ThiS; Provisional	Back alignment and domain information

>PF02597 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer	Back alignment and domain information

>PRK07696 sulfur carrier protein ThiS; Provisional	Back alignment and domain information

>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium)	Back alignment and domain information

>TIGR01683 thiS thiamine biosynthesis protein ThiS	Back alignment and domain information

>PRK06083 sulfur carrier protein ThiS; Provisional	Back alignment and domain information

>PF14453 ThiS-like: ThiS-like ubiquitin	Back alignment and domain information

>KOG0012 consensus DNA damage inducible protein [Replication, recombination and repair]	Back alignment and domain information

>PRK07440 hypothetical protein; Provisional	Back alignment and domain information

>PF09855 DUF2082: Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082); InterPro: IPR018652 This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins	Back alignment and domain information

>smart00666 PB1 PB1 domain	Back alignment and domain information

>smart00295 B41 Band 4	Back alignment and domain information

>KOG2086 consensus Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion [Nuclear structure]	Back alignment and domain information

>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines	Back alignment and domain information

>cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases	Back alignment and domain information

>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA	Back alignment and domain information

>TIGR02958 sec_mycoba_snm4 secretion protein snm4	Back alignment and domain information

>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>smart00647 IBR In Between Ring fingers	Back alignment and domain information

>KOG0009 consensus Ubiquitin-like/40S ribosomal S30 protein fusion [Translation, ribosomal structure and biogenesis; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00455 RBD Raf-like Ras-binding domain	Back alignment and domain information

>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional	Back alignment and domain information

>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins	Back alignment and domain information

>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>PRK05978 hypothetical protein; Provisional	Back alignment and domain information

>smart00661 RPOL9 RNA polymerase subunit 9	Back alignment and domain information

>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]	Back alignment and domain information

>PRK11130 moaD molybdopterin synthase small subunit; Provisional	Back alignment and domain information

>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity	Back alignment and domain information

>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional	Back alignment and domain information

>PF02196 RBD: Raf-like Ras-binding domain; InterPro: IPR003116 This is the Ras-binding domain found in proteins related to Ras	Back alignment and domain information

>cd06411 PB1_p51 The PB1 domain is present in the p51 protein, a homolog of the p67 protein	Back alignment and domain information

>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain	Back alignment and domain information

>PF01907 Ribosomal_L37e: Ribosomal protein L37e; InterPro: IPR001569 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein	Back alignment and domain information

>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62	Back alignment and domain information

>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00280 L37a ribosomal protein L37a	Back alignment and domain information

>PRK01777 hypothetical protein; Validated	Back alignment and domain information

>cd06410 PB1_UP2 Uncharacterized protein 2	Back alignment and domain information

>PTZ00380 microtubule-associated protein (MAP); Provisional	Back alignment and domain information

>PF08825 E2_bind: E2 binding domain; InterPro: IPR014929 E1 and E2 enzymes play a central role in ubiquitin and ubiquitin-like protein transfer cascades	Back alignment and domain information

>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed	Back alignment and domain information

>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms]	Back alignment and domain information

>PRK09710 lar restriction alleviation and modification protein; Reviewed	Back alignment and domain information

>cd01766 Ufm1 Urm1-like ubiquitin domain	Back alignment and domain information

>cd01787 GRB7_RA RA (RAS-associated like) domain of Grb7	Back alignment and domain information

>PTZ00255 60S ribosomal protein L37a; Provisional	Back alignment and domain information

>PF04758 Ribosomal_S30: Ribosomal protein S30; InterPro: IPR006846 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>PF13248 zf-ribbon_3: zinc-ribbon domain	Back alignment and domain information

>cd01764 Urm1 Urm1-like ubuitin domain	Back alignment and domain information

>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2	Back alignment and domain information

>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]	Back alignment and domain information

>smart00154 ZnF_AN1 AN1-like Zinc finger	Back alignment and domain information

>COG5349 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>smart00144 PI3K_rbd PI3-kinase family, Ras-binding domain	Back alignment and domain information

>PF10209 DUF2340: Uncharacterized conserved protein (DUF2340); InterPro: IPR018794 This entry consists of small proteins of approximately 150 amino acids whose function is unknown	Back alignment and domain information

>PF13719 zinc_ribbon_5: zinc-ribbon domain	Back alignment and domain information

>PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []	Back alignment and domain information

>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues	Back alignment and domain information

>PRK09336 30S ribosomal protein S30e; Provisional	Back alignment and domain information

>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C	Back alignment and domain information

>PF00788 RA: Ras association (RalGDS/AF-6) domain; InterPro: IPR000159 Proteins with this domain are mostly RasGTP effectors and include guanine-nucleotide releasing factor in mammals []	Back alignment and domain information

>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]	Back alignment and domain information

>PF02017 CIDE-N: CIDE-N domain; InterPro: IPR003508 This domain consists of caspase-activated (CAD) nucleases, which induce DNA fragmentation and chromatin condensation during apoptosis, and the cell death activator proteins CIDE-A and CIDE-B, which are inhibitors of CAD nuclease	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		156
3u5g_f		152	The Structure Of The Eukaryotic Ribosome At 3.0 A R		1e-54
3u5c_f		152	The Structure Of The Eukaryotic Ribosome At 3.0 A R		2e-50
3olm_D		79	Structure And Function Of A Ubiquitin Binding Site		4e-38
3l0w_B		169	Structure Of Split Monoubiquitinated Pcna With Ubiq		6e-38
1otr_B		76	Solution Structure Of A Cue-Ubiquitin Complex Lengt		7e-38
3u5e_m		128	The Structure Of The Eukaryotic Ribosome At 3.0 A R		7e-38
4ii3_B		96	Crystal Structure Of S. Pombe Ubiquitin Activating		9e-38
4hcn_B		98	Crystal Structure Of Burkholderia Pseudomallei Effe		1e-37
1yx5_B		98	Solution Structure Of S5a Uim-1UBIQUITIN COMPLEX Le		2e-37
2jwz_A		76	Mutations In The Hydrophobic Core Of Ubiquitin Diff		3e-37
2zvn_A		154	Nemo Cozi Domain Incomplex With Diubiquitin In P212		3e-37
3b08_A		152	Crystal Structure Of The Mouse Hoil1-L-Nzf In Compl		4e-37
3nob_A		78	Structure Of K11-Linked Di-Ubiquitin Length = 78		4e-37
3u30_A		172	Crystal Structure Of A Linear-Specific Ubiquitin Fa		4e-37
2w9n_A		152	Crystal Structure Of Linear Di-Ubiquitin Length = 1		4e-37
4ap4_C		80	Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le		4e-37
1aar_A		76	Structure Of A Diubiquitin Conjugate And A Model Fo		4e-37
3jvz_X		81	E2~ubiquitin-Hect Length = 81		4e-37
2khw_B		79	Solution Structure Of The Human Polymerase Iota Ubm		4e-37
2ld9_A		77	Backbone Structure Of Ubiquitin Determined Using Ba		5e-37
3dvg_X		80	Crystal Structure Of K63-Specific Fab Apu.3a8 Bound		5e-37
2znv_C		77	Crystal Structure Of Human Amsh-Lp Dub Domain In Co		5e-37
2ojr_A		111	Structure Of Ubiquitin Solved By Sad Using The Lant		6e-37
3vdz_A		111	Tailoring Encodable Lanthanide-Binding Tags As Mri		7e-37
3zf7_s		128	High-resolution Cryo-electron Microscopy Structure		8e-37
4a18_K		129	T.Thermophila 60s Ribosomal Subunit In Complex With		8e-37
4ii2_B		83	Crystal Structure Of Ubiquitin Activating Enzyme 1		8e-37
2znv_B		76	Crystal Structure Of Human Amsh-Lp Dub Domain In Co		8e-37
1zgu_B		76	Solution Structure Of The Human Mms2-Ubiquitin Comp		8e-37
3dvg_Y		79	Crystal Structure Of K63-Specific Fab Apu.3a8 Bound		9e-37
1yiw_A		76	X-Ray Crystal Structure Of A Chemically Synthesized		1e-36
3q3f_A		189	Engineering Domain-Swapped Binding Interfaces By Mu		1e-36
2y5b_B		152	Structure Of Usp21 In Complex With Linear Diubiquit		1e-36
2kdi_A		114	Solution Structure Of A UbiquitinUIM FUSION PROTEIN		2e-36
3rul_A		79	New Strategy To Analyze Structures Of Glycopeptide-		2e-36
2o6v_D		76	Crystal Structure And Solution Nmr Studies Of Lys48		2e-36
1xd3_B		75	Crystal Structure Of Uchl3-Ubvme Complex Length = 7		2e-36
1cmx_B		76	Structural Basis For The Specificity Of Ubiquitin C		2e-36
2xk5_B		76	Crystal Structure Of K6-Linked Diubiquitin Length =		2e-36
3k9o_B		96	The Crystal Structure Of E2-25k And Ubb+1 Complex L		2e-36
1s1q_B		76	Tsg101(Uev) Domain In Complex With Ubiquitin Length		3e-36
2k6d_B		76	Cin85 Sh3-C Domain In Complex With Ubiquitin Length		3e-36
2o6v_B		76	Crystal Structure And Solution Nmr Studies Of Lys48		4e-36
2k25_A		103	Automated Nmr Structure Of The Ubb By Fapsy Length		4e-36
1yj1_A		76	X-Ray Crystal Structure Of A Chemically Synthesized		7e-36
1ogw_A		76	Synthetic Ubiquitin With Fluoro-Leu At 50 And 67 Le		8e-36
2fcs_A		76	X-Ray Crystal Structure Of A Chemically Synthesized		8e-36
3ai5_A		307	Crystal Structure Of Yeast Enhanced Green Fluoresce		1e-35
2gbr_A		81	Crystal Structure Of The 35-36 Moad Insertion Mutan		2e-35
3ldz_F		73	Crystal Structure Of Human Stam1 Vhs Domain In Comp		3e-35
2zcb_A		76	Crystal Structure Of Ubiquitin P37aP38A Length = 76		3e-35
3h7s_B		76	Crystal Structures Of K63-Linked Di- And Tri-Ubiqui		4e-35
2gbk_A		83	Crystal Structure Of The 9-10 Moad Insertion Mutant		5e-35
1ud7_A		76	Solution Structure Of The Designed Hydrophobic Core		5e-35
3ons_A		72	Crystal Structure Of Human Ubiquitin In A New Cryst		1e-34
1c3t_A		76	Rotamer Strain As A Determinant Of Protein Structur		1e-34
4gsw_A		80	Crystal Structure Of Ubiquitin From Entamoeba Histo		1e-34
1zw7_A		82	Elimination Of The C-Cap In Ubiquitin Structure, Dy		2e-34
3v6e_B		91	Crystal Structure Of Usp2 And A Mutant Form Of Ubiq		2e-34
1sif_A		88	Crystal Structure Of A Multiple Hydrophobic Core Mu		2e-34
2gbj_A		84	Crystal Structure Of The 9-10 8 Glycine Insertion M		4e-34
2gbm_A		84	Crystal Structure Of The 35-36 8 Glycine Insertion		4e-34
3v6c_B		91	Crystal Structure Of Usp2 In Complex With Mutated U		4e-34
4hjk_A		77	U7ub7 Disulfide Variant Length = 77		5e-32
4i6l_B		76	Crystal Structure Of Otub1 In Complex With Ubiquiti		5e-32
3mtn_B		85	Usp21 In Complex With A Ubiquitin-based, Usp21-spec		1e-30
2jvc_A		82	Nmr Solution Structure Of Ubiquitin Like Protein Le		2e-30
4hk2_A		78	U7ub25.2540 Length = 78		7e-30
3n3k_B		85	The Catalytic Domain Of Usp8 In Complex With A Usp8		5e-26
1gjz_A		53	Solution Structure Of A Dimeric N-Terminal Fragment		3e-22
1bt0_A		76	Structure Of Ubiquitin-Like Protein, Rub1 Length =		4e-22
3dbh_I		88	Structural Dissection Of A Gating Mechanism Prevent		6e-21
3dbl_I		88	Structural Dissection Of A Gating Mechanism Prevent		2e-20
4hcp_B		78	Crystal Structure Of Burkholderia Pseudomallei Effe		5e-20
2nvu_I		81	Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1		5e-20
4f8c_B		88	Structure Of The Cif:nedd8 Complex - Yersinia Pseud		5e-20
2bkr_B		77	Nedd8 Nedp1 Complex Length = 77		6e-20
1ndd_B		76	Structure Of Nedd8 Length = 76		7e-20
3gzn_I		82	Structure Of Nedd8-Activating Enzyme In Complex Wit		7e-20
3dqv_A		81	Structural Insights Into Nedd8 Activation Of Cullin		3e-19
3zey_9		153	High-resolution Cryo-electron Microscopy Structure		6e-17
2xzm_9		189	Crystal Structure Of The Eukaryotic 40s Ribosomal S		3e-13
2dzi_A		81	2dziSOLUTION STRUCTURE OF THE N-Terminal Ubiquitin-		2e-10
2zeq_A		78	Crystal Structure Of Ubiquitin-Like Domain Of Murin		4e-08
2knb_A		81	Solution Nmr Structure Of The Parkin Ubl Domain In		5e-08
1iyf_A		81	Solution Structure Of Ubiquitin-Like Domain Of Huma		7e-08
3b1l_X		76	Crystal Structure Of Parkin Ubiquitin-Like Domain R		7e-08
3sdl_C		164	Crystal Structure Of Human Isg15 In Complex With Ns		9e-08
3rt3_B		159	Complex Of Influenza Virus Protein With Host Anti-V		1e-07
3r66_C		164	Crystal Structure Of Human Isg15 In Complex With Ns		1e-07
2hj8_A		88	Solution Nmr Structure Of The C-Terminal Domain Of		1e-07
2l7r_A		93	Solution Nmr Structure Of N-Terminal Ubiquitin-Like		4e-07
2faz_A		78	Ubiquitin-Like Domain Of Human Nuclear Zinc Finger		4e-07
3pse_B		156	Structure Of A Viral Otu Domain Protease Bound To I		5e-07
3phx_B		79	Otu Domain Of Crimean Congo Hemorrhagic Fever Virus		6e-07
1wy8_A		89	Solution Structure Of The N-Terminal Ubiquitin-Like		2e-06
1zkh_A		86	Solution Structure Of A Human Ubiquitin-Like Domain		2e-06
3j20_Y		50	Promiscuous Behavior Of Proteins In Archaeal Riboso		2e-06
1z2m_A		155	Crystal Structure Of Isg15, The Interferon-Induced		3e-06
1wh3_A		87	Solution Structure Of C-Terminal Ubiquitin Like Dom		3e-06
1wx9_A		86	Solution Structure Of The N-Terminal Ubiquitin-Like		5e-06
1we7_A		115	Solution Structure Of Ubiquitin-Like Domain In Sf3a		7e-06
4dwf_A		90	Crystal Structure Of A Hla-B Associated Transcript		8e-06
4eew_A		88	Crystal Structure Of The Ubl Domain Of Bag6 Length		2e-05
1ttn_A		106	Solution Structure Of The Ubiquitin-Like Domain Of		3e-05
3m63_B		101	Crystal Structure Of Ufd2 In Complex With The Ubiqu		5e-05
2bwe_S		77	The Crystal Structure Of The Complex Between The Ub		6e-05
1p1a_A		85	Nmr Structure Of Ubiquitin-Like Domain Of Hhr23b Le		6e-05
1uel_A		95	Solution Structure Of Ubiquitin-Like Domain Of Hhr2		9e-05
2k4x_A		55	Solution Structure Of 30s Ribosomal Protein S27a Fr		9e-05
2wyq_A		85	The Crystal Structure Of The Ubiquitin-Like (Ubl) D		6e-04

>pdb|3U5G|FF Chain f, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 40s Subunit, Ribosome B Length = 152