Citrus Sinensis ID: 031615

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------

MAGVGEAQRRQAGRSRPLHPSGRGPPPPPPRPRFEPVDREKTCPLLLRVFTKIGGHHSREDFAVRGKEPKDEVQIYTWKDATLRELTDLVKEVAPAARRRDARLSFAFVYPDKNGRFMVREVGKTFSYEGRRQLDDGKMLAELGFEIGDYLDVAIL

ccccccHHHcccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccEEEEEcccccHHHHHHHHHHHcccccccccEEEEEEEECccccccEEEEEEEEEcccccccccccccccccccccccEEEEEEc

****************************************KTCPLLLRVFTKIGGHHSREDFAVRG***KDEVQIYTWKDATLRELTDLVKEVAPAARRRDARLSFAFVYPDKNGRFMVREVGKTFSYEGRRQLDDGKMLAELGFEIGDYLDVAIL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAGVGEAQRRQAGRSRPLHPSGRGPPPPPPRPRFEPVDREKTCPLLLRVFTKIGGHHSREDFAVRGKEPKDEVQIYTWKDATLRELTDLVKEVAPAARRRDARLSFAFVYPDKNGRFMVREVGKTFSYEGRRQLDDGKMLAELGFEIGDYLDVAIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Histone deacetylase complex subunit SAP18	Links the histone deacetylase complex to transcriptional repressors bound to chromatin. Involved in the tethering of the SIN3 complex to core histone proteins.	confident	O64644
Histone deacetylase complex subunit SAP18	Component of the SIN3-repressing complex. Enhances the ability of SIN3-HDAC1-mediated transcriptional repression. When tethered to the promoter, it can direct the formation of a repressive complex to core histone proteins. Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism.	probable	Q5RDT5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A6Q, chain A
Confidence level:very confident
Coverage over the Query: 32-156
View the alignment between query and template
View the model in PyMOL