Citrus Sinensis ID: 031619

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MAVPRNGMMEEDDSEEDNALFEEDGVNMDLESETPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDGDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTDCDDQNDLVR
ccccccHHHcccccHHHHHHHHHcccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccccc
ccccccccccHHccccccHHHHcccccccccccccHHHHHHHHHHHcccHHHHHHHHccccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccHHHcccccccccccccHHHHHHHcc
mavprngmmeeddseednalfeedgvnmdlesetpphlRDLAAAAQLGDVHSLRLALDnlsgsidepvedgdtALHLTCLYGYLPCVQLLLERgasleakdedgaiplhdacaGGFIEIVQLLINSASGTECVKRMLETvdaegdtdcddqndlvr
mavprngmmeeddseedNALFEEDGVNMDLESETPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDGDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLEtvdaegdtdcddqndlvr
MAVPRNGMMEEDDSEEDNALFEEDGVNMDLESETPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDGDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTDCDDQNDLVR
*******************************************AAQLGDVHSLRLALDNLSGSIDEPVEDGDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLE******************
MAVPRNGMMEEDDSEEDNALFEEDGVNMDLESETPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDGDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTDCDDQND*V*
****************DNALFEEDGVNMDLESETPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDGDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTDCDDQNDLVR
***************EDNALFEEDGVNMDLESETPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDGDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETV***GDTDCDDQ***V*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVPRNGMMEEDDSEEDNALFEEDGVNMDLESETPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDGDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTDCDDQNDLVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query156 2.2.26 [Sep-21-2011]
Q9SAR5342 Ankyrin repeat domain-con no no 0.506 0.230 0.462 2e-10
Q8VBX0 278 Ankyrin repeat and SOCS b yes no 0.557 0.312 0.408 8e-09
Q54GC8288 Acyl-CoA-binding domain-c yes no 0.615 0.333 0.322 1e-08
Q9VSA4 1405 Tonsoku-like protein OS=D no no 0.455 0.050 0.341 2e-08
O75179 2603 Ankyrin repeat domain-con no no 0.583 0.034 0.358 2e-08
Q99NH0 2603 Ankyrin repeat domain-con no no 0.583 0.034 0.358 2e-08
Q8WXK3 278 Ankyrin repeat and SOCS b no no 0.557 0.312 0.397 3e-08
Q01484 3957 Ankyrin-2 OS=Homo sapiens no no 0.538 0.021 0.4 3e-08
Q12955 4377 Ankyrin-3 OS=Homo sapiens no no 0.711 0.025 0.330 5e-08
Q6PFX9 1320 Tankyrase-1 OS=Mus muscul no no 0.397 0.046 0.430 6e-08
>sp|Q9SAR5|AKR2_ARATH Ankyrin repeat domain-containing protein 2 OS=Arabidopsis thaliana GN=AKR2 PE=1 SV=2 Back     alignment and function desciption
 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 45  AQLGDVHSLRLALDNLSGSIDEPVEDGDTALHLTCLYGYLPCVQLLLERGASLEAKDEDG 104
           A LGDV  L+ AL +  G+ DE   +G TALH  C YG L C Q+L++ GAS+ A D++ 
Sbjct: 226 ASLGDVEGLKAALAS-GGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNK 284

Query: 105 AIPLHDACAGGFIEIVQLLI 124
             PLH A   G  E V LL+
Sbjct: 285 NTPLHYAAGYGRKECVSLLL 304
Seems to be involved in the regulation of hydrogen peroxide levels during biotic and abiotic stresses by optimizing the ascorbate peroxidase 3 (APX3) hydrogen peroxide-degrading activity. This regulation might be monitored by GRF6.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 Back     alignment and function description
>sp|Q54GC8|ACBD6_DICDI Acyl-CoA-binding domain-containing protein 6 homolog OS=Dictyostelium discoideum GN=acbd6 PE=3 SV=1 Back     alignment and function description
>sp|Q9VSA4|TONSL_DROME Tonsoku-like protein OS=Drosophila melanogaster GN=CG7457 PE=1 SV=1 Back     alignment and function description
>sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 Back     alignment and function description
>sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 Back     alignment and function description
>sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
449440147209 PREDICTED: tankyrase-1-like [Cucumis sat 0.929 0.693 0.791 1e-57
255556842203 ankyrin repeat-containing protein, putat 0.929 0.714 0.780 1e-55
351725263204 uncharacterized protein LOC100527544 [Gl 0.929 0.710 0.736 1e-54
225441151201 PREDICTED: BRCA1-associated RING domain 0.910 0.706 0.777 1e-54
356533285204 PREDICTED: ankyrin-1-like [Glycine max] 0.929 0.710 0.743 2e-54
224068837201 predicted protein [Populus trichocarpa] 0.929 0.721 0.773 4e-52
388499846203 unknown [Medicago truncatula] 0.923 0.709 0.736 4e-52
224140249197 predicted protein [Populus trichocarpa] 0.929 0.736 0.773 2e-50
18398673206 ankyrin repeat-containing protein [Arabi 0.935 0.708 0.702 2e-47
6681330185 hypothetical protein [Arabidopsis thalia 0.935 0.789 0.702 2e-47
>gi|449440147|ref|XP_004137846.1| PREDICTED: tankyrase-1-like [Cucumis sativus] gi|449501039|ref|XP_004161261.1| PREDICTED: tankyrase-1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 135/149 (90%), Gaps = 4/149 (2%)

Query: 1   MAVP--RNGMMEEDDSEEDNALFEEDGVNMDLESETPPHLRDLAAAAQLGDVHSLRLALD 58
           MAVP  RNG+++EDD EEDNALFEEDGV ++ +S+TPPHLR LA AAQLGDV  LR ALD
Sbjct: 1   MAVPGRRNGVVDEDDHEEDNALFEEDGV-IEFDSDTPPHLRPLATAAQLGDVDCLRTALD 59

Query: 59  NLS-GSIDEPVEDGDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFI 117
           NL+ GSI++ VEDGDTALHLTCLYG+LPCV+LLLERGA+LE +DEDGAIPLHDACAGGF+
Sbjct: 60  NLTLGSINDAVEDGDTALHLTCLYGHLPCVRLLLERGAALEVQDEDGAIPLHDACAGGFV 119

Query: 118 EIVQLLINSASGTECVKRMLETVDAEGDT 146
           EIVQLLINSA+ TECVKRMLE+VDAEGDT
Sbjct: 120 EIVQLLINSANDTECVKRMLESVDAEGDT 148

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255556842|ref|XP_002519454.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223541317|gb|EEF42868.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351725263|ref|NP_001237598.1| uncharacterized protein LOC100527544 [Glycine max] gi|255632580|gb|ACU16640.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225441151|ref|XP_002267396.1| PREDICTED: BRCA1-associated RING domain protein 1 [Vitis vinifera] gi|297739983|emb|CBI30165.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356533285|ref|XP_003535196.1| PREDICTED: ankyrin-1-like [Glycine max] Back     alignment and taxonomy information
>gi|224068837|ref|XP_002326212.1| predicted protein [Populus trichocarpa] gi|222833405|gb|EEE71882.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388499846|gb|AFK37989.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224140249|ref|XP_002323496.1| predicted protein [Populus trichocarpa] gi|222868126|gb|EEF05257.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18398673|ref|NP_566360.1| ankyrin repeat-containing protein [Arabidopsis thaliana] gi|21554034|gb|AAM63115.1| unknown [Arabidopsis thaliana] gi|89001029|gb|ABD59104.1| At3g09890 [Arabidopsis thaliana] gi|110743883|dbj|BAE99776.1| hypothetical protein [Arabidopsis thaliana] gi|332641305|gb|AEE74826.1| ankyrin repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|6681330|gb|AAF23247.1|AC015985_5 hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
TAIR|locus:2085094206 AT3G09890 [Arabidopsis thalian 0.935 0.708 0.702 3.8e-53
ZFIN|ZDB-GENE-091118-116 294 asb13b "ankyrin repeat and SOC 0.512 0.272 0.451 6.6e-12
UNIPROTKB|E1BJ12 278 ASB13 "Uncharacterized protein 0.519 0.291 0.402 2.5e-11
TAIR|locus:2827572344 AKR2B "ankyrin repeat-containi 0.551 0.25 0.443 4e-11
UNIPROTKB|F1RYV8 278 ASB13 "Uncharacterized protein 0.519 0.291 0.402 4.3e-11
MGI|MGI:2145525 278 Asb13 "ankyrin repeat and SOCS 0.519 0.291 0.426 4.3e-11
RGD|1310387 278 Asb13 "ankyrin repeat and SOCS 0.512 0.287 0.445 7.3e-11
UNIPROTKB|F1P8J7 284 ASB13 "Uncharacterized protein 0.519 0.285 0.414 8e-11
MGI|MGI:1920312 524 Ppp1r16a "protein phosphatase 0.903 0.269 0.342 1.2e-10
ZFIN|ZDB-GENE-051023-5168 ppp1r27 "protein phosphatase 1 0.564 0.523 0.386 1.5e-10
TAIR|locus:2085094 AT3G09890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 550 (198.7 bits), Expect = 3.8e-53, P = 3.8e-53
 Identities = 104/148 (70%), Positives = 124/148 (83%)

Query:     1 MAVPR--NGMMEEDDSEEDNALFEEDGVNMDLESETPPHLRDLAAAAQLGDVHSLRLALD 58
             MAVPR  NG+ EE+D + +NA+FEE+GV+ D +SE P HLRDLAAAAQ GDV +LR A+D
Sbjct:     1 MAVPRGGNGLNEEEDVDGENAIFEENGVDYDTDSELPSHLRDLAAAAQAGDVAALRTAID 60

Query:    59 NLSGSIDEPVEDGDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIE 118
             NL+G +DEP+ED D+ALHL CLYG+LPCVQLLLERGA +E KDED AIPLHDACAGG++E
Sbjct:    61 NLNGRVDEPLEDNDSALHLACLYGHLPCVQLLLERGADMEVKDEDEAIPLHDACAGGYLE 120

Query:   119 IVQLLINSASGTECVKRMLETVDAEGDT 146
             IVQLL + AS  ECVKRM+ET D EGDT
Sbjct:   121 IVQLLFSRASSPECVKRMIETADIEGDT 148
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005829 "cytosol" evidence=IDA
ZFIN|ZDB-GENE-091118-116 asb13b "ankyrin repeat and SOCS box containing 13b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BJ12 ASB13 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2827572 AKR2B "ankyrin repeat-containing 2B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1RYV8 ASB13 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2145525 Asb13 "ankyrin repeat and SOCS box-containing 13" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310387 Asb13 "ankyrin repeat and SOCS box-containing 13" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1P8J7 ASB13 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1920312 Ppp1r16a "protein phosphatase 1, regulatory (inhibitor) subunit 16A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051023-5 ppp1r27 "protein phosphatase 1, regulatory subunit 27" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00000603001
SubName- Full=Chromosome chr8 scaffold_106, whole genome shotgun sequence; (201 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00007629001
SubName- Full=Chromosome chr2 scaffold_196, whole genome shotgun sequence; (174 aa)
  •     0.451
GSVIVG00011614001
SubName- Full=Chromosome chr5 scaffold_322, whole genome shotgun sequence; Flags- Fragment; (205 aa)
  •     0.405

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-17
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-17
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-14
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-08
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 7e-07
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 7e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 9e-05
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-04
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-04
smart0024830 smart00248, ANK, ankyrin repeats 5e-04
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 5e-04
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 6e-04
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 6e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.001
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.001
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.001
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.002
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 72.8 bits (179), Expect = 3e-17
 Identities = 37/97 (38%), Positives = 56/97 (57%), Gaps = 6/97 (6%)

Query: 28  MDLESETPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDGDTALHLTCLYGYLPCV 87
            D +  TP HL     AA+ G +  ++L L+     ++   +DG+T LHL    G L  V
Sbjct: 36  KDNDGRTPLHL-----AAKNGHLEIVKLLLEKG-ADVNARDKDGNTPLHLAARNGNLDVV 89

Query: 88  QLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLI 124
           +LLL+ GA + A+D+DG  PLH A   G +E+V+LL+
Sbjct: 90  KLLLKHGADVNARDKDGRTPLHLAAKNGHLEVVKLLL 126

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 156
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.97
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.95
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.94
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.93
PHA02859209 ankyrin repeat protein; Provisional 99.92
PHA02791 284 ankyrin-like protein; Provisional 99.91
PHA02791 284 ankyrin-like protein; Provisional 99.91
PHA02878 477 ankyrin repeat protein; Provisional 99.91
PHA02874 434 ankyrin repeat protein; Provisional 99.91
KOG0508 615 consensus Ankyrin repeat protein [General function 99.9
PHA03095 471 ankyrin-like protein; Provisional 99.9
PHA02875 413 ankyrin repeat protein; Provisional 99.9
PHA02878 477 ankyrin repeat protein; Provisional 99.9
PHA02875 413 ankyrin repeat protein; Provisional 99.9
PHA03100 480 ankyrin repeat protein; Provisional 99.9
PHA02946 446 ankyin-like protein; Provisional 99.9
PHA02874 434 ankyrin repeat protein; Provisional 99.9
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.9
PHA02795 437 ankyrin-like protein; Provisional 99.89
PHA02741169 hypothetical protein; Provisional 99.89
PHA02884 300 ankyrin repeat protein; Provisional 99.89
PHA02859209 ankyrin repeat protein; Provisional 99.89
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.89
PHA03100 480 ankyrin repeat protein; Provisional 99.89
PHA03095 471 ankyrin-like protein; Provisional 99.88
PHA02798 489 ankyrin-like protein; Provisional 99.88
PHA02798 489 ankyrin-like protein; Provisional 99.88
PHA02743166 Viral ankyrin protein; Provisional 99.88
PHA02946 446 ankyin-like protein; Provisional 99.87
PHA02989 494 ankyrin repeat protein; Provisional 99.87
PHA02876 682 ankyrin repeat protein; Provisional 99.87
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.87
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.86
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.86
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.86
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.86
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.85
KOG0510 929 consensus Ankyrin repeat protein [General function 99.85
PHA02730 672 ankyrin-like protein; Provisional 99.85
PHA02876 682 ankyrin repeat protein; Provisional 99.84
PHA02917 661 ankyrin-like protein; Provisional 99.84
PHA02989 494 ankyrin repeat protein; Provisional 99.84
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.83
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.83
KOG0508 615 consensus Ankyrin repeat protein [General function 99.83
PHA02795 437 ankyrin-like protein; Provisional 99.83
PHA02736154 Viral ankyrin protein; Provisional 99.83
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.82
PHA02884 300 ankyrin repeat protein; Provisional 99.81
PHA02792 631 ankyrin-like protein; Provisional 99.81
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.81
KOG0510 929 consensus Ankyrin repeat protein [General function 99.78
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.78
PHA02741169 hypothetical protein; Provisional 99.78
PHA02917 661 ankyrin-like protein; Provisional 99.77
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.76
PHA02736154 Viral ankyrin protein; Provisional 99.76
KOG0514452 consensus Ankyrin repeat protein [General function 99.76
PHA02792 631 ankyrin-like protein; Provisional 99.75
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.75
PHA02730 672 ankyrin-like protein; Provisional 99.74
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.74
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.73
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.72
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.71
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.7
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.68
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.67
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.66
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.65
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.65
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.64
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.63
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.63
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.59
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.55
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.55
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.54
KOG0514452 consensus Ankyrin repeat protein [General function 99.53
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.52
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.48
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.42
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.41
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.35
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.3
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.28
KOG0515 752 consensus p53-interacting protein 53BP/ASPP, conta 99.26
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 99.26
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.23
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 99.2
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.18
KOG0705749 consensus GTPase-activating protein Centaurin gamm 99.13
PF1360630 Ank_3: Ankyrin repeat 98.97
PF1360630 Ank_3: Ankyrin repeat 98.97
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.96
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.89
KOG0522 560 consensus Ankyrin repeat protein [General function 98.85
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.84
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.83
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.82
KOG0522 560 consensus Ankyrin repeat protein [General function 98.76
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.73
KOG2384 223 consensus Major histocompatibility complex protein 98.65
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.59
KOG0511 516 consensus Ankyrin repeat protein [General function 98.52
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.51
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.42
KOG0511 516 consensus Ankyrin repeat protein [General function 98.41
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.25
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.13
KOG2384223 consensus Major histocompatibility complex protein 98.0
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.93
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.47
KOG2505591 consensus Ankyrin repeat protein [General function 97.42
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.38
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.3
KOG2505591 consensus Ankyrin repeat protein [General function 97.24
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.07
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 89.25
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 88.45
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 86.34
KOG1709 271 consensus Guanidinoacetate methyltransferase and r 86.33
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 83.09
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.97  E-value=9.3e-30  Score=161.87  Aligned_cols=129  Identities=27%  Similarity=0.354  Sum_probs=115.8

Q ss_pred             HHHhHHHHhcCCccCCCCCCCchHHHHHHHHhcCCHHHHHHHHHhCCCCCCccCCCCCcHHHHHHhcCCHHHHHHHHHcC
Q 031619           15 EEDNALFEEDGVNMDLESETPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDGDTALHLTCLYGYLPCVQLLLERG   94 (156)
Q Consensus        15 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~ll~~~   94 (156)
                      -++++++++ -.++..++.+..|++|||.|+..|+.++|+.|+...|+++|...+.|.|+||||+..+..+++.+|+..|
T Consensus        51 ~eiv~fLls-q~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~advna~tn~G~T~LHyAagK~r~eIaqlLle~g  129 (226)
T KOG4412|consen   51 VEIVYFLLS-QPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADVNATTNGGQTCLHYAAGKGRLEIAQLLLEKG  129 (226)
T ss_pred             hhHHHHHHh-cCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCcceecCCCcceehhhhcCChhhHHHHHHhcC
Confidence            457777775 3445556667799999999999999999999998888999999999999999999999999999999999


Q ss_pred             CCCCccCCCCCChHHHHHhCChHHHHHHHHHcccCchHHhhhhcccccCCCchhhhh
Q 031619           95 ASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTDCDDQ  151 (156)
Q Consensus        95 ~~~~~~~~~g~tpL~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~g~tpl~~a  151 (156)
                      +.++++|..|+||||-|+.-|..+++++|+..|+.+       |.+|.+|+||||.|
T Consensus       130 a~i~~kD~~~qtplHRAAavGklkvie~Li~~~a~~-------n~qDk~G~TpL~~a  179 (226)
T KOG4412|consen  130 ALIRIKDKQGQTPLHRAAAVGKLKVIEYLISQGAPL-------NTQDKYGFTPLHHA  179 (226)
T ss_pred             CCCcccccccCchhHHHHhccchhhHHHHHhcCCCC-------CcccccCccHHHHH
Confidence            999999999999999999999999999999999887       59999999999998

>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-10
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 6e-10
2xee_A157 Structural Determinants For Improved Thermal Stabil 4e-09
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 4e-09
2xeh_A157 Structural Determinants For Improved Thermal Stabil 4e-09
3utm_A 351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 5e-09
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 5e-09
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 6e-09
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 6e-09
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 7e-09
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 8e-09
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-08
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-08
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 1e-08
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-08
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 3e-08
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-08
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-08
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 7e-08
1s70_B 299 Complex Between Protein Ser/thr Phosphatase-1 (delt 8e-08
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 1e-07
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-07
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-07
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-07
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-07
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-07
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 3e-07
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 3e-07
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-07
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 3e-07
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 4e-07
3zkj_A 261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 6e-07
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 7e-07
3d9h_A 285 Crystal Structure Of The Splice Variant Of Human As 7e-07
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 9e-07
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-06
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 3e-06
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 3e-06
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-06
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-06
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 4e-06
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 5e-06
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 5e-06
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 6e-06
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 6e-06
3aji_A 231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 6e-06
1uoh_A 226 Human Gankyrin Length = 226 6e-06
1qym_A 227 X-Ray Structure Of Human Gankyrin Length = 227 6e-06
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 7e-06
2dvw_A 231 Structure Of The Oncoprotein Gankyrin In Complex Wi 7e-06
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 8e-06
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 1e-05
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 3e-05
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 6e-05
1ycs_B239 P53-53bp2 Complex Length = 239 7e-05
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 9e-05
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 9e-05
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 9e-05
1dcq_A278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 9e-05
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 1e-04
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-04
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 2e-04
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-04
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 2e-04
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 4e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 4e-04
2xen_A91 Structural Determinants For Improved Thermal Stabil 4e-04
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 5e-04
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 6e-04
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 6e-04
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure 
Iteration: 1

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 57/100 (57%), Gaps = 6/100 (6%)
Query: 29  DLESETPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDGDTALHLTCLYGYLPCVQ 88
           D    TP HL     AA+ G +  ++L L+     ++   ++G T LHL    G+L  V+
Sbjct: 32  DKNGRTPLHL-----AARNGHLEVVKLLLE-AGADVNAKDKNGRTPLHLAARNGHLEVVK 85
Query: 89  LLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSAS 128
           LLLE GA + AKD++G  PLH A   G +E+V+LL+ + +
Sbjct: 86  LLLEAGADVNAKDKNGRTPLHLAARNGHLEVVKLLLEAGA 125
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-19
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-16
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-16
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-15
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-15
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-14
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-19
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-17
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-14
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-06
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-19
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-17
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-10
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-18
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-15
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 4e-15
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-13
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 8e-13
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-06
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-18
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-18
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-18
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-14
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-09
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-18
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-18
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-17
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-18
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-13
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-17
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-04
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-16
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-17
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-13
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-18
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 1e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-14
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 4e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-17
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-11
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-17
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-15
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-15
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-09
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-09
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-04
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-17
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-09
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-05
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-17
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-15
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-17
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-16
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-16
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-16
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-16
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-16
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-15
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-05
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-17
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-15
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-13
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-17
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-17
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 9e-16
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-13
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-12
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-08
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-17
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-15
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-08
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-17
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-15
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-10
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-17
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-17
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 9e-17
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 1e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-15
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-17
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-15
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-14
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-09
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 9e-17
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-16
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 1e-15
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-15
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-15
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 9e-17
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-16
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-16
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 6e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-14
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-13
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-16
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-13
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-16
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-16
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-15
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-16
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-16
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-15
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-16
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-16
3hra_A 201 Ankyrin repeat family protein; structural protein; 5e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-13
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-12
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-16
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-14
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-16
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 9e-15
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-14
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 3e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-04
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 6e-16
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-14
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-14
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 1e-06
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-16
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-12
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-15
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-15
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-14
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-14
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-15
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-14
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-07
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-10
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-10
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-09
2rfa_A 232 Transient receptor potential cation channel subfa 1e-14
2rfa_A 232 Transient receptor potential cation channel subfa 6e-12
2rfa_A232 Transient receptor potential cation channel subfa 3e-11
2rfa_A232 Transient receptor potential cation channel subfa 1e-10
2rfa_A232 Transient receptor potential cation channel subfa 5e-10
2rfa_A232 Transient receptor potential cation channel subfa 2e-07
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 3e-14
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 6e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-13
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 3e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-04
2etb_A256 Transient receptor potential cation channel subfam 4e-12
2etb_A256 Transient receptor potential cation channel subfam 4e-11
2etb_A 256 Transient receptor potential cation channel subfam 4e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-12
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-04
2pnn_A273 Transient receptor potential cation channel subfa 7e-12
2pnn_A273 Transient receptor potential cation channel subfa 7e-09
2pnn_A273 Transient receptor potential cation channel subfa 4e-08
2pnn_A273 Transient receptor potential cation channel subfa 8e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-11
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 8e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-11
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-08
3jxi_A 260 Vanilloid receptor-related osmotically activated p 4e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-04
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-07
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-04
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.98
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.95
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.95
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.94
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
2etb_A256 Transient receptor potential cation channel subfam 99.94
3hra_A201 Ankyrin repeat family protein; structural protein; 99.94
2pnn_A273 Transient receptor potential cation channel subfa 99.94
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.94
2rfa_A232 Transient receptor potential cation channel subfa 99.94
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.94
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.94
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.94
2rfa_A232 Transient receptor potential cation channel subfa 99.94
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.94
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.93
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.93
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.93
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.93
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.93
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.93
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.93
3hra_A201 Ankyrin repeat family protein; structural protein; 99.93
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.93
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.93
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 99.93
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.93
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.93
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.93
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.93
2etb_A256 Transient receptor potential cation channel subfam 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.93
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.93
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.93
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.93
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.92
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.92
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.92
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.92
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.92
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.92
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.92
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.92
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.92
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.92
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.92
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.92
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.92
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.92
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.91
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.91
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.91
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.91
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.91
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.91
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.91
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.91
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.91
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.91
2pnn_A273 Transient receptor potential cation channel subfa 99.91
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.91
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.9
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.9
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.9
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.9
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.9
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.89
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.89
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.89
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.89
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.87
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.87
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.87
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.86
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.85
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.85
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.85
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 99.85
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.83
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.83
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.81
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.81
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.79
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.77
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.98  E-value=2.2e-31  Score=173.59  Aligned_cols=133  Identities=29%  Similarity=0.454  Sum_probs=123.7

Q ss_pred             CChHHHhHHHHhcCCccCCCCCCCchHHHHHHHHhcCCHHHHHHHHHhCCCCCCccCCCCCcHHHHHHhcCCHHHHHHHH
Q 031619           12 DDSEEDNALFEEDGVNMDLESETPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDGDTALHLTCLYGYLPCVQLLL   91 (156)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~ll   91 (156)
                      .+..+.++.+++.|.++|..  +..+.||||+|+..++.++++++++. |++++.++..|+||||+|+..++.+++++|+
T Consensus        14 ~G~~~~v~~Ll~~Gadvn~~--d~~g~t~l~~a~~~~~~~~~~~ll~~-gad~~~~d~~g~TpLh~A~~~g~~~~v~~Ll   90 (169)
T 4gpm_A           14 NGNKDRVKDLIENGADVNAS--DSDGRTPLHHAAENGHKEVVKLLISK-GADVNAKDSDGRTPLHHAAENGHKEVVKLLI   90 (169)
T ss_dssp             TTCHHHHHHHHHTTCCTTCC--CTTSCCHHHHHHHTTCHHHHHHHHHT-TCCTTCCCTTSCCHHHHHHHTTCHHHHHHHH
T ss_pred             cCCHHHHHHHHHCCCCCCCc--CCCCCCHHHHHHHcCCHHHHHHHHhc-ccchhhhccCCCCHHHHHHHcCCHHHHHHHH
Confidence            45677888899999887654  45788999999999999999999998 9999999999999999999999999999999


Q ss_pred             HcCCCCCccCCCCCChHHHHHhCChHHHHHHHHHcccCchHHhhhhcccccCCCchhhhhhhh
Q 031619           92 ERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTDCDDQNDL  154 (156)
Q Consensus        92 ~~~~~~~~~~~~g~tpL~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~g~tpl~~a~~~  154 (156)
                      +.|++++.+|..|.||||+|+..|+.+++++|+++|++++       .+|.+|+||||+|++.
T Consensus        91 ~~gadvn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~-------~~d~~G~TpL~~A~~~  146 (169)
T 4gpm_A           91 SKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVN-------TSDSDGRTPLDLAREH  146 (169)
T ss_dssp             HTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTT-------CCCTTSCCHHHHHHHT
T ss_pred             HCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCcc-------ccCCCCCCHHHHHHHc
Confidence            9999999999999999999999999999999999999985       8999999999999863
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 156
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-16
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-13
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-09
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-07
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-06
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-14
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-06
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-12
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-11
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-10
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.002
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-10
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-09
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-10
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 8e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-10
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-06
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-05
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-05
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.001
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 9e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-10
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.002
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-05
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-07
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 8e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.002
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.004
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.004
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 71.2 bits (173), Expect = 7e-16
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 6/92 (6%)

Query: 34  TPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDGDTALHLTCLYGYLPCVQLLLER 93
           TP H+     A+ +G +  ++  L     S +      +T LH+    G+    + LL+ 
Sbjct: 2   TPLHV-----ASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQN 55

Query: 94  GASLEAKDEDGAIPLHDACAGGFIEIVQLLIN 125
            A + AK +D   PLH A   G   +V+LL+ 
Sbjct: 56  KAKVNAKAKDDQTPLHCAARIGHTNMVKLLLE 87
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.96
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.94
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.91
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.91
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.9
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.9
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.89
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.89
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.88
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.88
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.88
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.88
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.86
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.85
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.85
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.85
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.83
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.82
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.82
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.81
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.81
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.8
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.8
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.79
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.78
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.77
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1sw6a_ 301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.61
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.96  E-value=1.3e-29  Score=154.58  Aligned_cols=107  Identities=22%  Similarity=0.384  Sum_probs=103.2

Q ss_pred             HHHHHHHHhcCCHHHHHHHHHhCCCCCCccCCCCCcHHHHHHhcCCHHHHHHHHHcCCCCCccCCCCCChHHHHHhCChH
Q 031619           38 LRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDGDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFI  117 (156)
Q Consensus        38 ~~~l~~a~~~~~~~~v~~ll~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~g~tpL~~a~~~~~~  117 (156)
                      .|||++|+..|+.+++++|+++ |++++.++..|+||||+|+..++.+++++++..|++++.+|..|.||||+|+..|+.
T Consensus         3 ~tpL~~A~~~g~~~~v~~Ll~~-g~d~n~~~~~g~t~lh~A~~~~~~~~~~~ll~~g~din~~d~~g~tpLh~A~~~~~~   81 (118)
T d1myoa_           3 DKEFMWALKNGDLDEVKDYVAK-GEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHV   81 (118)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHTT-TCCCCCCSSSSCCTTHHHHHHSTTTHHHHHHHSSCTTTCCSSSCSCHHHHHHTTTCC
T ss_pred             ChHHHHHHHCCCHHHHHHHHHh-hhccccccccccccccccccccccccccccccccceeeecccccccchhhhhhcCch
Confidence            4799999999999999999998 999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcccCchHHhhhhcccccCCCchhhhhh
Q 031619          118 EIVQLLINSASGTECVKRMLETVDAEGDTDCDDQN  152 (156)
Q Consensus       118 ~~~~~Ll~~~~~~~~~~~~~~~~~~~g~tpl~~a~  152 (156)
                      +++++|+++|++++       .+|.+|.||||+|.
T Consensus        82 ~~v~~Ll~~Gad~~-------~~d~~G~t~l~~a~  109 (118)
T d1myoa_          82 SCVKLLLSKGADKT-------VKGPDGLTALEATD  109 (118)
T ss_dssp             HHHHHHHTTCCCSS-------SSSSSTCCCCCTCS
T ss_pred             hhhhhhhcccccce-------eeCCCCCCHHHHHh
Confidence            99999999999984       99999999999985
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure