Citrus Sinensis ID: 031653


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
MADGDADVAVAAAAGLPKKRTFKKFSFRGVDLDALLDMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK
ccccHHHHHHHHHHccccccccccEEcccccHHHHHcccHHHHHHHccHHHHHcccccccccHHHHHHHHHHHHHHcccccccccEEEEccccEEcccccccEEEEEccccccEEEEcccccEEccccccccccccccccccccccccccccccc
****************PKKRTFKKFSFRGVDLDALLDMSNDELVKLFSARARRRFQRGLKRKPMALIKKL****************RTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADGDADVAVAAAAGLPKKRTFKKFSFRGVDLDALLDMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein S15 confidentP34737
40S ribosomal protein S15 confidentP31674
40S ribosomal protein S15 confidentQ56K10

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IZ6, chain R
Confidence level:very confident
Coverage over the Query: 59-149
View the alignment between query and template
View the model in PyMOL