Citrus Sinensis ID: 031658

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
MQKENSAPEGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSAKQFEVFDVELLSVQDCQRRTIGFYSDVVCN
cccccccccccccccHHcHHHHHccccccEEcccccEEEEEEcccccccccccEEEEEEEEEcccccEEEccccccccEEEEcccccEEccHHHHHcccccccEEEEEEccccccccccccccccccEEEEEEEEEEEEcccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHcccccEEcccccEEEEEEEccccccccccEEEEEEEEEEccccEEcccccccccEEEEccccccccccHHHHHccccccEEEEEEccHHccccccccccccccEEEEEEEEEEEccccccEEEEEccEEcc
mqkensapegfpnfirEGFEVKVvtsenytkrdsgliyrdfevgkgdcpkdgQQVIFHYIGynesgrridstylqgsparirmgtnalvpgfeegirdmrpggkrriiippelgppvgpstffsakqFEVFDVELLSVQDCQRRTIGFYSDVVCN
mqkensapegfpnfiregfevkvvtsenytkrdsgliyrDFEVGKGDCPKDGQQVIFHYIgynesgrriDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSAKQFEVFDVELLSVQdcqrrtigfysdvvcn
MQKENSAPEGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSAKQFEVFDVELLSVQDCQRRTIGFYSDVVCN
************NFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIR******KRRIIIPPELGPPVGPSTFFSAKQFEVFDVELLSVQDCQRRTIGFYSDVVC*
*******************EVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSAKQFEVFDVELLSVQDCQRRTIGFYSDVVCN
********EGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSAKQFEVFDVELLSVQDCQRRTIGFYSDVVCN
************NFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSAKQFEVFDVELLSVQDCQRRTIGFYSDVVCN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQKENSAPEGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSAKQFEVFDVELLSVQDCQRRTIGFYSDVVCN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query155 2.2.26 [Sep-21-2011]
Q0WRJ7242 Peptidyl-prolyl cis-trans yes no 1.0 0.640 0.833 1e-73
P65764270 FKBP-type peptidyl-prolyl yes no 0.632 0.362 0.366 4e-12
P65765270 FKBP-type peptidyl-prolyl N/A no 0.632 0.362 0.366 4e-12
P45523270 FKBP-type peptidyl-prolyl N/A no 0.632 0.362 0.366 5e-12
O22870223 Peptidyl-prolyl cis-trans no no 0.651 0.452 0.390 8e-12
P0A0W2109 FK506-binding protein OS= yes no 0.690 0.981 0.333 3e-11
Q9LYR5256 Peptidyl-prolyl cis-trans no no 0.716 0.433 0.314 5e-11
Q54NB6364 FK506-binding protein 4 O yes no 0.619 0.263 0.360 7e-11
P56989109 FK506-binding protein OS= yes no 0.664 0.944 0.336 9e-11
O81864229 Peptidyl-prolyl cis-trans no no 0.703 0.475 0.302 5e-10
>sp|Q0WRJ7|FK202_ARATH Peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic OS=Arabidopsis thaliana GN=FKBP20-2 PE=1 SV=1 Back     alignment and function desciption
 Score =  275 bits (702), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 146/156 (93%), Gaps = 1/156 (0%)

Query: 1   MQKENSAPEGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYI 60
           +Q+EN+AP+ FPNF+REGFEVKV+ S+NY K DSGLIYRDF VG+GD PKDGQQV FHYI
Sbjct: 87  IQRENNAPDEFPNFVREGFEVKVLASDNYIKADSGLIYRDFNVGQGDFPKDGQQVTFHYI 146

Query: 61  GYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVGPS 120
           GYNESGRRIDSTY+QGSPARIRMGTNALVPGFE GIRDM+PGG+RRIIIPPELGPPVGPS
Sbjct: 147 GYNESGRRIDSTYIQGSPARIRMGTNALVPGFEMGIRDMKPGGRRRIIIPPELGPPVGPS 206

Query: 121 TFFSAKQFEVFDVELLSVQDCQRRT-IGFYSDVVCN 155
           TFFS+KQFEVFDVELLS+Q+C+RRT IGFYSDV C+
Sbjct: 207 TFFSSKQFEVFDVELLSIQNCERRTIIGFYSDVTCS 242
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Involved in the accumulation of the PSII complex.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|P65764|FKBA_ECOL6 FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fkpA PE=3 SV=1 Back     alignment and function description
>sp|P65765|FKBA_ECO57 FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Escherichia coli O157:H7 GN=fkpA PE=3 SV=1 Back     alignment and function description
>sp|P45523|FKBA_ECOLI FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Escherichia coli (strain K12) GN=fkpA PE=1 SV=1 Back     alignment and function description
>sp|O22870|FK163_ARATH Peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic OS=Arabidopsis thaliana GN=FKBP16-3 PE=1 SV=2 Back     alignment and function description
>sp|P0A0W2|FKBP_NEIMB FK506-binding protein OS=Neisseria meningitidis serogroup B (strain MC58) GN=fbp PE=1 SV=1 Back     alignment and function description
>sp|Q9LYR5|FKB19_ARATH Peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic OS=Arabidopsis thaliana GN=FKBP19 PE=1 SV=1 Back     alignment and function description
>sp|Q54NB6|FKBP4_DICDI FK506-binding protein 4 OS=Dictyostelium discoideum GN=fkbp4 PE=1 SV=1 Back     alignment and function description
>sp|P56989|FKBP_NEIMA FK506-binding protein OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fbp PE=3 SV=1 Back     alignment and function description
>sp|O81864|FK171_ARATH Peptidyl-prolyl cis-trans isomerase FKBP17-1, chloroplastic OS=Arabidopsis thaliana GN=FKBP17-1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
224137178210 predicted protein [Populus trichocarpa] 1.0 0.738 0.890 2e-77
255541078 265 fk506-binding protein, putative [Ricinus 0.987 0.577 0.888 3e-76
225453422 258 PREDICTED: FKBP-type peptidyl-prolyl cis 0.993 0.596 0.883 3e-76
449431986 260 PREDICTED: peptidyl-prolyl cis-trans iso 0.993 0.592 0.876 4e-76
351726032248 uncharacterized protein LOC100305486 [Gl 1.0 0.625 0.870 5e-76
388505048246 unknown [Lotus japonicus] 1.0 0.630 0.871 4e-75
356520790248 PREDICTED: FKBP-type peptidyl-prolyl cis 1.0 0.625 0.858 1e-74
297820896244 immunophilin [Arabidopsis lyrata subsp. 1.0 0.635 0.846 1e-72
30695188242 FKBP-type peptidyl-prolyl cis-trans isom 1.0 0.640 0.833 6e-72
115472151 258 Os07g0490400 [Oryza sativa Japonica Grou 1.0 0.600 0.819 9e-72
>gi|224137178|ref|XP_002327057.1| predicted protein [Populus trichocarpa] gi|222835372|gb|EEE73807.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  292 bits (748), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 149/155 (96%)

Query: 1   MQKENSAPEGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYI 60
           +QKEN+ PE FP+FIREGFEVKVV  ENY KRDSGLIYRDFEVG+GDCPKDGQQV FHY+
Sbjct: 56  IQKENNVPEDFPSFIREGFEVKVVAPENYIKRDSGLIYRDFEVGEGDCPKDGQQVTFHYV 115

Query: 61  GYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVGPS 120
           GYNESGRRIDSTYLQGSPA+IRMGTNAL+PGFEEGIRDMRPGGKRRII+PPELGPPVGPS
Sbjct: 116 GYNESGRRIDSTYLQGSPAKIRMGTNALIPGFEEGIRDMRPGGKRRIIVPPELGPPVGPS 175

Query: 121 TFFSAKQFEVFDVELLSVQDCQRRTIGFYSDVVCN 155
           TFFS+KQFEVFDVELL+V+DCQRRTIGFYSDVVCN
Sbjct: 176 TFFSSKQFEVFDVELLNVKDCQRRTIGFYSDVVCN 210

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255541078|ref|XP_002511603.1| fk506-binding protein, putative [Ricinus communis] gi|223548783|gb|EEF50272.1| fk506-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225453422|ref|XP_002274957.1| PREDICTED: FKBP-type peptidyl-prolyl cis-trans isomerase 6, chloroplastic [Vitis vinifera] gi|297734593|emb|CBI16644.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449431986|ref|XP_004133781.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|351726032|ref|NP_001236089.1| uncharacterized protein LOC100305486 [Glycine max] gi|255625657|gb|ACU13173.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388505048|gb|AFK40590.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356520790|ref|XP_003529043.1| PREDICTED: FKBP-type peptidyl-prolyl cis-trans isomerase 6, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|297820896|ref|XP_002878331.1| immunophilin [Arabidopsis lyrata subsp. lyrata] gi|297324169|gb|EFH54590.1| immunophilin [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30695188|ref|NP_567098.2| FKBP-type peptidyl-prolyl cis-trans isomerase 6 [Arabidopsis thaliana] gi|122236257|sp|Q0WRJ7.1|FK202_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic; Short=PPIase FKBP20-2; AltName: Full=FK506-binding protein 20-2; Short=AtFKBP20-2; AltName: Full=Immunophilin FKBP20-2; AltName: Full=Rotamase; Flags: Precursor gi|110736573|dbj|BAF00252.1| hypothetical protein [Arabidopsis thaliana] gi|119360117|gb|ABL66787.1| At3g60370 [Arabidopsis thaliana] gi|332646531|gb|AEE80052.1| FKBP-type peptidyl-prolyl cis-trans isomerase 6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|115472151|ref|NP_001059674.1| Os07g0490400 [Oryza sativa Japonica Group] gi|33146997|dbj|BAC80069.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase; protein [Oryza sativa Japonica Group] gi|113611210|dbj|BAF21588.1| Os07g0490400 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
TAIR|locus:2103366242 AT3G60370 "AT3G60370" [Arabido 1.0 0.640 0.833 5.5e-70
UNIPROTKB|Q7XHR0258 P0477A12.35 "Peptidyl-prolyl c 1.0 0.600 0.819 4.9e-69
UNIPROTKB|A8HTG4269 FKB20-2 "Peptidyl-prolyl cis-t 0.987 0.568 0.623 5.8e-50
UNIPROTKB|Q7NMC5161 glr0841 "Peptidyl-prolyl cis-t 0.722 0.695 0.389 5.3e-17
UNIPROTKB|Q74AS7156 GSU2274 "Peptidyl-prolyl cis-t 0.677 0.673 0.396 1.1e-16
TIGR_CMR|GSU_2274156 GSU_2274 "FKBP-type peptidyl-p 0.677 0.673 0.396 1.1e-16
UNIPROTKB|P45523270 fkpA [Escherichia coli K-12 (t 0.851 0.488 0.342 4.7e-16
UNIPROTKB|A9WGZ8 237 Caur_0860 "Peptidyl-prolyl cis 0.677 0.443 0.415 1.3e-15
UNIPROTKB|Q9KV04259 VC_0354 "Peptidyl-prolyl cis-t 0.774 0.463 0.344 2.3e-14
TIGR_CMR|VC_0354259 VC_0354 "peptidyl-prolyl cis-t 0.774 0.463 0.344 2.3e-14
TAIR|locus:2103366 AT3G60370 "AT3G60370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 709 (254.6 bits), Expect = 5.5e-70, P = 5.5e-70
 Identities = 130/156 (83%), Positives = 146/156 (93%)

Query:     1 MQKENSAPEGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYI 60
             +Q+EN+AP+ FPNF+REGFEVKV+ S+NY K DSGLIYRDF VG+GD PKDGQQV FHYI
Sbjct:    87 IQRENNAPDEFPNFVREGFEVKVLASDNYIKADSGLIYRDFNVGQGDFPKDGQQVTFHYI 146

Query:    61 GYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVGPS 120
             GYNESGRRIDSTY+QGSPARIRMGTNALVPGFE GIRDM+PGG+RRIIIPPELGPPVGPS
Sbjct:   147 GYNESGRRIDSTYIQGSPARIRMGTNALVPGFEMGIRDMKPGGRRRIIIPPELGPPVGPS 206

Query:   121 TFFSAKQFEVFDVELLSVQDCQRRTI-GFYSDVVCN 155
             TFFS+KQFEVFDVELLS+Q+C+RRTI GFYSDV C+
Sbjct:   207 TFFSSKQFEVFDVELLSIQNCERRTIIGFYSDVTCS 242
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IDA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0005576 "extracellular region" evidence=ISM
GO:0006457 "protein folding" evidence=IEA
GO:0016020 "membrane" evidence=IBA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0009543 "chloroplast thylakoid lumen" evidence=IDA
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0010207 "photosystem II assembly" evidence=RCA;IMP
GO:0016491 "oxidoreductase activity" evidence=IDA
GO:0006364 "rRNA processing" evidence=RCA
GO:0009902 "chloroplast relocation" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
GO:0042793 "transcription from plastid promoter" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
UNIPROTKB|Q7XHR0 P0477A12.35 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8HTG4 FKB20-2 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|Q7NMC5 glr0841 "Peptidyl-prolyl cis-trans isomerase" [Gloeobacter violaceus PCC 7421 (taxid:251221)] Back     alignment and assigned GO terms
UNIPROTKB|Q74AS7 GSU2274 "Peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2274 GSU_2274 "FKBP-type peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P45523 fkpA [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|A9WGZ8 Caur_0860 "Peptidyl-prolyl cis-trans isomerase" [Chloroflexus aurantiacus J-10-fl (taxid:324602)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KV04 VC_0354 "Peptidyl-prolyl cis-trans isomerase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0354 VC_0354 "peptidyl-prolyl cis-trans isomerase, FKBP-type" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0WRJ7FK202_ARATH5, ., 2, ., 1, ., 80.83331.00.6404yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.963
4th Layer5.2.1.80.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_40000135
hypothetical protein (210 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.X.2120.1
RecName- Full=Peptidyl-prolyl cis-trans isomerase; EC=5.2.1.8; (156 aa)
  •     0.496
estExt_Genewise1_v1.C_LG_VII1249
hypothetical protein (113 aa)
  •   • 0.484
eugene3.00080515
hypothetical protein (206 aa)
  •     0.482

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 1e-22
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 3e-19
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 3e-18
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 8e-10
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 5e-06
PRK15095156 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis- 2e-05
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 88.6 bits (220), Expect = 1e-22
 Identities = 47/113 (41%), Positives = 62/113 (54%), Gaps = 17/113 (15%)

Query: 34  SGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFE 93
           SGL Y+  + G G  PK G  V  HY G    G   DS+Y +G PA   +G   ++PG++
Sbjct: 101 SGLQYKVLKAGDGAAPKKGDTVTVHYTGTLIDGTVFDSSYDRGQPAEFPLG--GVIPGWD 158

Query: 94  EGIRDMRPGGKRRIIIPPELG------PPVGP--STFFSAKQFEVFDVELLSV 138
           EG++ M+ GGKR++ IPPEL       P V P  ST        VF+VELL V
Sbjct: 159 EGLQGMKVGGKRKLTIPPELAYGERGVPGVIPPNSTL-------VFEVELLDV 204

Length = 205
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|237908 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 155
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 100.0
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.96
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.96
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.95
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.95
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.95
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.93
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.87
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.78
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.76
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.71
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.68
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 99.31
PRK01490 435 tig trigger factor; Provisional 99.23
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 99.21
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.07
KOG0545 329 consensus Aryl-hydrocarbon receptor-interacting pr 98.39
KOG0549 188 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.4
PRK05753137 nucleoside diphosphate kinase regulator; Provision 83.31
PRK00226157 greA transcription elongation factor GreA; Reviewe 81.86
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=7e-33  Score=203.06  Aligned_cols=126  Identities=35%  Similarity=0.615  Sum_probs=116.3

Q ss_pred             CcccccccccccccCCCeeeCCCCeEEEEEEcCCCCCCCCCCEEEEEEEEEeCCCCEEeccccCCccEEEEeCCCCcchH
Q 031658           12 PNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPG   91 (155)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~~~~Gv~y~v~~~G~G~~~~~gd~V~v~y~~~~~dg~~~~st~~~~~p~~~~~g~~~~~~g   91 (155)
                      +.-..+.|++.+.+.+.++++++|+.|++++.|+|..++.++.|.+||++++.||++|+||++++.|+.|.+|  .+|+|
T Consensus        79 ~~~~~~~f~~~~~k~~~v~~~~sgl~y~~~~~G~G~~~~~~~~V~vhY~G~l~~G~vFDsS~~rg~p~~f~l~--~vI~G  156 (205)
T COG0545          79 NAAEGKAFLEKNAKEKGVKTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLIDGTVFDSSYDRGQPAEFPLG--GVIPG  156 (205)
T ss_pred             hHHhHHHHHhhhcccCCceECCCCcEEEEEeccCCCCCCCCCEEEEEEEEecCCCCccccccccCCCceeecC--Ceeeh
Confidence            3344566888888899999999999999999999999999999999999999999999999999999999996  99999


Q ss_pred             HHHHHcCCCCccEEEEEeCCCCCCCCCC-CCCCCCCCeEEEEEEEEeee
Q 031658           92 FEEGIRDMRPGGKRRIIIPPELGPPVGP-STFFSAKQFEVFDVELLSVQ  139 (155)
Q Consensus        92 l~~~l~~m~~Ge~~~v~ip~~~~yg~~~-~~~ip~~~~l~~~v~vl~v~  139 (155)
                      |.++|.+|++|++|+++||+++|||... +..|||+++|+|+|+|++|.
T Consensus       157 w~egl~~M~vG~k~~l~IP~~laYG~~g~~g~Ippns~LvFeVeLl~v~  205 (205)
T COG0545         157 WDEGLQGMKVGGKRKLTIPPELAYGERGVPGVIPPNSTLVFEVELLDVK  205 (205)
T ss_pred             HHHHHhhCCCCceEEEEeCchhccCcCCCCCCCCCCCeEEEEEEEEecC
Confidence            9999999999999999999999999555 55599999999999999974

>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05753 nucleoside diphosphate kinase regulator; Provisional Back     alignment and domain information
>PRK00226 greA transcription elongation factor GreA; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 7e-14
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 1e-13
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-13
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 2e-13
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 2e-13
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-13
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-13
1q6u_A245 Crystal Structure Of Fkpa From Escherichia Coli Len 5e-13
1q6h_A224 Crystal Structure Of A Truncated Form Of Fkpa From 5e-13
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-12
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 7e-12
1u79_A129 Crystal Structure Of Atfkbp13 Length = 129 2e-10
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 9e-09
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 1e-08
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 1e-08
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 1e-08
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 1e-08
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 2e-08
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 2e-08
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 2e-08
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 2e-08
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 2e-08
3jxv_A 356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 3e-08
3jym_A 377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 3e-08
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 4e-08
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 4e-08
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 6e-08
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 1e-07
2pbc_A102 Fk506-Binding Protein 2 Length = 102 1e-07
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 3e-07
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 7e-07
1fd9_A213 Crystal Structure Of The Macrophage Infectivity Pot 1e-05
1jvw_A167 Trypanosoma Cruzi Macrophage Infectivity Potentiato 1e-05
2uz5_A137 Solution Structure Of The Fkbp-Domain Of Legionella 1e-05
4dip_A125 Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran 1e-05
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 3e-04
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 3e-04
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 3e-04
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 3e-04
3b7x_A134 Crystal Structure Of Human Fk506-Binding Protein 6 3e-04
2ki3_A126 Structural And Biochemical Characterization Of Fk50 3e-04
3o5d_A 264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 3e-04
1kt1_A 457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 4e-04
1kt0_A 457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 5e-04
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 7e-04
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 7e-04
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure 
Iteration: 1

 Score = 72.8 bits (177), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 64/127 (50%), Gaps = 7/127 (5%)
Query: 13  NFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDST 72
             +  G  + VVT+E      SGL Y D   G G   + GQ V  HY G+   G++ DS+
Sbjct: 13  GLVPRGSHMTVVTTE------SGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSS 66
Query: 73  YLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPV-GPSTFFSAKQFEVF 131
             +  P    +G   ++ G++EG++ M+ GG RR+ IPP+LG    G           VF
Sbjct: 67  KDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVF 126
Query: 132 DVELLSV 138
           +VELL V
Sbjct: 127 EVELLDV 133
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|1FD9|A Chain A, Crystal Structure Of The Macrophage Infectivity Potentiator Protein (Mip) A Major Virulence Factor From Legionella Pneumophila Length = 213 Back     alignment and structure
>pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Infectivity Potentiator (Tcmip) Length = 167 Back     alignment and structure
>pdb|2UZ5|A Chain A, Solution Structure Of The Fkbp-Domain Of Legionella Pneumophila Mip Length = 137 Back     alignment and structure
>pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|3B7X|A Chain A, Crystal Structure Of Human Fk506-Binding Protein 6 Length = 134 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 1e-27
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 3e-27
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 7e-27
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 1e-26
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 2e-26
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 2e-26
1fd9_A213 Protein (macrophage infectivity potentiator prote; 5e-26
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 1e-25
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 3e-25
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 5e-25
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 8e-25
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 4e-17
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-15
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 8e-25
1jvw_A167 Macrophage infectivity potentiator; chagas disease 1e-24
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 3e-24
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 5e-24
2ppn_A107 FK506-binding protein 1A; high resolution protein 6e-24
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 8e-24
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 3e-23
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-13
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 1e-22
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 1e-21
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 6e-21
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 8e-20
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-19
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 3e-10
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 5e-19
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 2e-18
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 3e-17
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 3e-14
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 1e-12
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 3e-12
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 2e-11
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 4e-11
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 2e-09
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 2e-09
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 1e-08
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 7e-08
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
 Score =  101 bits (252), Expect = 1e-27
 Identities = 41/128 (32%), Positives = 62/128 (48%), Gaps = 15/128 (11%)

Query: 19  FEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSP 78
              + +        +SGL Y D   G G   + GQ V  HY G+   G++ DS+  +  P
Sbjct: 89  AHREQIGGSTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDP 148

Query: 79  ARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELG------PPVGP--STFFSAKQFEV 130
               +G   ++ G++EG++ M+ GG RR+ IPP+LG        V P  +T        V
Sbjct: 149 FAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAAGVIPPNATL-------V 201

Query: 131 FDVELLSV 138
           F+VELL V
Sbjct: 202 FEVELLDV 209
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.96
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.96
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.96
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.96
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.96
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.96
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.96
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.95
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.95
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.95
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.95
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.95
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.95
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.95
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.95
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.95
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.95
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.95
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.95
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.95
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.94
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.94
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.91
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.91
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.89
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.89
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.88
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.88
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.85
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.81
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.77
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.77
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.77
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.76
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.74
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.74
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.74
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.68
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.67
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 99.58
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.52
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.3
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 98.59
2p4v_A158 Transcription elongation factor GREB; transcript c 80.86
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
Probab=99.96  E-value=1.9e-29  Score=182.42  Aligned_cols=127  Identities=28%  Similarity=0.453  Sum_probs=115.7

Q ss_pred             ccccccccccccCCCeeeCCCCeEEEEEEcCCCCC-CCCCCEEEEEEEEEeCCCCEEeccccCCccEEEEeCCCCcchHH
Q 031658           14 FIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDC-PKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGF   92 (155)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~~~Gv~y~v~~~G~G~~-~~~gd~V~v~y~~~~~dg~~~~st~~~~~p~~~~~g~~~~~~gl   92 (155)
                      ...+.|++.+...++++++++|++|+++++|+|.. ++.||.|.|||++++.||++|++++..+.|+.|.+  +.+++||
T Consensus        17 ~~~~~~l~~~~~~~~~~~~~sGl~~~vl~~G~G~~~~~~gd~V~v~Y~g~l~dG~~fdss~~~g~p~~f~l--g~vI~G~   94 (167)
T 1jvw_A           17 RVGRLFMEQKAAQPDAVKLPSGLVFQRIARGSGKRAPAIDDKCEVHYTGRLRDGTVFDSSRERGKPTTFRP--NEVIKGW   94 (167)
T ss_dssp             HHHHHHHHHHHHSTTEEECTTSCEEEEEECCCCSBCCCTTCCEEEEEEEECTTSCEEEEHHHHTSCEEECG--GGSCHHH
T ss_pred             HHHHHHHHhcccCCCcEECCCCEEEEEEEcCCCCcCCCCCCEEEEEEEEEECCCCEEeeccccCCCEEEEe--CchhHHH
Confidence            34567788888889999999999999999999998 99999999999999999999999987678999999  5899999


Q ss_pred             HHHHcCCCCccEEEEEeCCCCCCCC-CCCCCCCCCCeEEEEEEEEeeecCC
Q 031658           93 EEGIRDMRPGGKRRIIIPPELGPPV-GPSTFFSAKQFEVFDVELLSVQDCQ  142 (155)
Q Consensus        93 ~~~l~~m~~Ge~~~v~ip~~~~yg~-~~~~~ip~~~~l~~~v~vl~v~~~~  142 (155)
                      +++|.+|++|++++|.||++++||. +..+.|||+++|+|+|+|+++.+.+
T Consensus        95 eeaL~gMk~Ge~~~~~Ip~~laYG~~g~~~~Ipp~s~LiF~VeL~~i~~~~  145 (167)
T 1jvw_A           95 TEALQLMREGDRWRLFIPYDLAYGVTGGGGMIPPYSPLEFDVELISIKDGG  145 (167)
T ss_dssp             HHHHTTCCTTCEEEEEECGGGTTTTTCSSSSSCTTCCEEEEEEEEEEGGGC
T ss_pred             HHHHcCCCCCCEEEEEECchhhCCCCCCCCCcCCCCeEEEEEEEEEEEcCC
Confidence            9999999999999999999999994 4455799999999999999998654
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>2p4v_A Transcription elongation factor GREB; transcript cleavage, GRE-factors, RNA polymerase; 2.60A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 155
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 8e-19
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 5e-18
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 2e-17
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 4e-17
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 9e-17
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 1e-16
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 2e-16
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 3e-16
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 1e-14
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 1e-13
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 1e-13
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 8e-11
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 8e-09
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 2e-08
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Peptidyl-prolyl cis-trans isomerase FkpA
species: Escherichia coli [TaxId: 562]

 Score = 77.2 bits (189), Expect = 8e-19
 Identities = 44/128 (34%), Positives = 70/128 (54%), Gaps = 16/128 (12%)

Query: 19  FEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSP 78
           +  K    +      +GL+Y+  E GKG+ PKD   V+ +Y G    G+  D++Y +G P
Sbjct: 92  YREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEP 151

Query: 79  ARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELG------PPVGP-STFFSAKQFEVF 131
              R+    ++PG+ EG+++++ GGK +++IPPEL       P + P ST        VF
Sbjct: 152 LSFRLD--GVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTL-------VF 202

Query: 132 DVELLSVQ 139
           DVELL V+
Sbjct: 203 DVELLDVK 210
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.97
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.97
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.97
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.96
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.96
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.96
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.96
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.96
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.95
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.92
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.9
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.74
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.69
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 99.4
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 99.3
d2f23a279 GreA transcript cleavage factor, C-terminal domain 87.42
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Macrophage infectivity potentiator protein (MIP)
species: Legionella pneumophila [TaxId: 446]

Probab=99.97  E-value=1e-31  Score=198.43  Aligned_cols=123  Identities=25%  Similarity=0.399  Sum_probs=114.6

Q ss_pred             ccccccccccCCCeeeCCCCeEEEEEEcCCCCCCCCCCEEEEEEEEEeCCCCEEeccccCCccEEEEeCCCCcchHHHHH
Q 031658           16 REGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEG   95 (155)
Q Consensus        16 ~~~~~~~~~~~~~~~~~~~Gv~y~v~~~G~G~~~~~gd~V~v~y~~~~~dg~~~~st~~~~~p~~~~~g~~~~~~gl~~~   95 (155)
                      .+.|++.+...++++++++|++|+++++|+|..|..||.|.+||++++.||++|++|+..+.|+.|.+  +.+++||+++
T Consensus        80 ~~~fl~~~~~~~~v~~~~sGl~y~v~~~G~G~~p~~~d~v~v~y~g~l~dg~~f~~s~~~~~p~~~~~--~~~i~G~~e~  157 (204)
T d1fd9a_          80 GEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQV--SQVIPGWTEA  157 (204)
T ss_dssp             HHHHHHHHHHSTTEEECTTSCEEEEEECCCSCCCCTTCEEEEEEEEEETTSCEEEEHHHHCSCEEEEG--GGSCHHHHHH
T ss_pred             HHHHHHhcccCCceEEecCccEEEEeecCCCcccCCCCEEEEEEEEEECCCCEecccccCCCCceecC--CccchhHHHH
Confidence            45688888888999999999999999999999999999999999999999999999998888988887  5799999999


Q ss_pred             HcCCCCccEEEEEeCCCCCCC-CCCCCCCCCCCeEEEEEEEEeeec
Q 031658           96 IRDMRPGGKRRIIIPPELGPP-VGPSTFFSAKQFEVFDVELLSVQD  140 (155)
Q Consensus        96 l~~m~~Ge~~~v~ip~~~~yg-~~~~~~ip~~~~l~~~v~vl~v~~  140 (155)
                      |.+|++|++++++|||+++|| .+.++.|||+++|+|+|+|++|++
T Consensus       158 l~~m~~G~~~~~~iP~~laYG~~g~~~~Ipp~s~l~feveL~~i~k  203 (204)
T d1fd9a_         158 LQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKK  203 (204)
T ss_dssp             HTTCCTTCEEEEEECGGGTTTTCCCSSSCCTTCCEEEEEEEEEEEC
T ss_pred             hcCCCCCCEEEEEEChHHCcCCCCCCCCcCcCCcEEEEEEEEEEEc
Confidence            999999999999999999999 555677999999999999999986
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2f23a2 d.26.1.2 (A:78-156) GreA transcript cleavage factor, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure