Citrus Sinensis ID: 031699


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MKMAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQLKVWVPVLVVPSKSK
ccEEEcccccccccccccccccEEEEccccccccHHHHHHHHHHHHHHccEEEEEEccHHHHHccccccccccHHHHHHHHHHHHHHHccccEEEEEECccccccccccccccEEEEcccccccHHHHHHHHHHcccccCEEEEEEEEEccccc
******************NSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQLKVWVPVLVVP****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQLKVWVPVLVVPSKSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphopantetheine adenylyltransferase Reversibly transfers an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate. Does not accept 4'-phosphopantothenoylcysteine as a substrate.probableQ9ZPV8
Phosphopantetheine adenylyltransferase Reversibly transfers an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate.probableQ8TGY4
Phosphopantetheine adenylyltransferase Reversibly transfers an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate.probableC5A3G3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.7.-Nucleotidyltransferases.probable
2.7.7.33-methyl-2-oxobutanoate dehydrogenase (ferredoxin).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DO8, chain A
Confidence level:very confident
Coverage over the Query: 23-150
View the alignment between query and template
View the model in PyMOL