Citrus Sinensis ID: 031699

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MKMAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQLKVWVPVLVVPSKSK
ccEEEcccccccccccccccccEEEEccccccccHHHHHHHHHHHHHHccEEEEEEccHHHHHccccccccccHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccEEEEcccccccHHHHHHHHHHcccccEEEEEEEEEEccccc
ccEEEEccccccccccccccccEEEEEccHHHHcHHHHHHHHHHHHHHcccEEEEEccHHHHHcccHHHHHccHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccEEEEcccccHHHHHHHHHHHHccccccEEEEEEEEEccccc
MKMAILDESvvnsnispdnsygaVVLGgtfdrlhdghRLFLKASAELARDRIVvgvcdgpmltnKQFAELIQPVDERMRNVEAYIKSIkpelvvqtepitdpygpsivdeNLEAIVVSketlpgglsvnkkradrglsqlkVWVPVLVVPSKSK
MKMAILDESVvnsnispdnSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIksikpelvvqtepiTDPYGPSIVDENLEAIVVSKetlpgglsvnkkradrglsqlkvwvpvlvvpsksk
MKMAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQLKVWVPVLVVPSKSK
******************NSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNK*RADRGLSQLKVWVPVLVV*****
**********************AVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQLKVWVPV*VVP****
MKMAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQLKVWVPVLVVPSKSK
*KMAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQLKVWVPVLVVP****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQLKVWVPVLVVPSKSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query154 2.2.26 [Sep-21-2011]
Q9ZPV8176 Phosphopantetheine adenyl yes no 0.863 0.755 0.849 2e-65
P53332305 Phosphopantetheine adenyl yes no 0.818 0.413 0.412 1e-24
Q9DBL7 563 Bifunctional coenzyme A s yes no 0.870 0.238 0.402 1e-24
Q8MIR4 562 Bifunctional coenzyme A s yes no 0.870 0.238 0.402 2e-24
Q13057 564 Bifunctional coenzyme A s yes no 0.870 0.237 0.395 4e-24
Q8ZY96155 Phosphopantetheine adenyl yes no 0.766 0.761 0.450 2e-19
Q10350316 Uncharacterized protein C yes no 0.824 0.401 0.330 9e-19
Q8TGY4157 Phosphopantetheine adenyl yes no 0.831 0.815 0.361 5e-16
O27918164 Phosphopantetheine adenyl yes no 0.759 0.713 0.368 6e-16
C5A3G3159 Phosphopantetheine adenyl yes no 0.837 0.811 0.371 5e-14
>sp|Q9ZPV8|COAD_ARATH Phosphopantetheine adenylyltransferase OS=Arabidopsis thaliana GN=COAD PE=1 SV=1 Back     alignment and function desciption
 Score =  247 bits (631), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 113/133 (84%), Positives = 127/133 (95%)

Query: 12  NSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELI 71
           +S +SP NS+GAVVLGGTFDRLHDGHR+FLKA+AELARDRIVVGVCDGPMLT KQF+++I
Sbjct: 6   DSKMSPANSFGAVVLGGTFDRLHDGHRMFLKAAAELARDRIVVGVCDGPMLTKKQFSDMI 65

Query: 72  QPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKK 131
           QP++ERMRNVE Y+KSIKPELVVQ EPITDPYGPSIVDENLEAIVVSKETLPGGLSVN+K
Sbjct: 66  QPIEERMRNVETYVKSIKPELVVQAEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNRK 125

Query: 132 RADRGLSQLKVWV 144
           RA+RGLSQLK+ V
Sbjct: 126 RAERGLSQLKIEV 138
Reversibly transfers an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate. Does not accept 4'-phosphopantothenoylcysteine as a substrate.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 3
>sp|P53332|COAD_YEAST Phosphopantetheine adenylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAB4 PE=1 SV=1 Back     alignment and function description
>sp|Q9DBL7|COASY_MOUSE Bifunctional coenzyme A synthase OS=Mus musculus GN=Coasy PE=1 SV=2 Back     alignment and function description
>sp|Q8MIR4|COASY_PIG Bifunctional coenzyme A synthase OS=Sus scrofa GN=COASY PE=1 SV=1 Back     alignment and function description
>sp|Q13057|COASY_HUMAN Bifunctional coenzyme A synthase OS=Homo sapiens GN=COASY PE=1 SV=4 Back     alignment and function description
>sp|Q8ZY96|COAD_PYRAE Phosphopantetheine adenylyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=coaD PE=3 SV=1 Back     alignment and function description
>sp|Q10350|YDA8_SCHPO Uncharacterized protein C1F12.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.08 PE=4 SV=2 Back     alignment and function description
>sp|Q8TGY4|COAD_METKA Phosphopantetheine adenylyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=coaD PE=3 SV=1 Back     alignment and function description
>sp|O27918|COAD_METTH Phosphopantetheine adenylyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=coaD PE=3 SV=2 Back     alignment and function description
>sp|C5A3G3|COAD_THEGJ Phosphopantetheine adenylyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=coaD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
297832482176 4-phosphopantetheine adenylyltransferase 0.863 0.755 0.864 2e-64
224133810178 predicted protein [Populus trichocarpa] 0.974 0.842 0.807 2e-64
255561104 493 syntaxin, putative [Ricinus communis] gi 0.922 0.288 0.823 8e-64
15224138176 phosphopantetheine adenylyltransferase [ 0.863 0.755 0.849 1e-63
225460271174 PREDICTED: phosphopantetheine adenylyltr 0.974 0.862 0.781 6e-62
359476888 493 PREDICTED: syntaxin-112 [Vitis vinifera] 0.889 0.277 0.824 7e-62
296089428 372 unnamed protein product [Vitis vinifera] 0.974 0.403 0.781 1e-61
297735135174 unnamed protein product [Vitis vinifera] 0.889 0.787 0.824 2e-61
449529337178 PREDICTED: phosphopantetheine adenylyltr 0.980 0.848 0.741 1e-59
449432834178 PREDICTED: phosphopantetheine adenylyltr 0.980 0.848 0.735 3e-59
>gi|297832482|ref|XP_002884123.1| 4-phosphopantetheine adenylyltransferase [Arabidopsis lyrata subsp. lyrata] gi|297329963|gb|EFH60382.1| 4-phosphopantetheine adenylyltransferase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 128/133 (96%)

Query: 12  NSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELI 71
           +S +SP NS+GAVVLGGTFDRLHDGHR+FLKA+AELARDRIVVGVCDGPMLTNKQFAE+I
Sbjct: 6   DSKMSPVNSFGAVVLGGTFDRLHDGHRMFLKAAAELARDRIVVGVCDGPMLTNKQFAEMI 65

Query: 72  QPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKK 131
           QP++ERMRNVE Y+KSIKPELVVQ EPI+DPYGPSIVDENLEAIVVSKETLPGGLSVN+K
Sbjct: 66  QPIEERMRNVEKYVKSIKPELVVQAEPISDPYGPSIVDENLEAIVVSKETLPGGLSVNRK 125

Query: 132 RADRGLSQLKVWV 144
           RA+RGLSQLK+ V
Sbjct: 126 RAERGLSQLKIEV 138

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224133810|ref|XP_002327686.1| predicted protein [Populus trichocarpa] gi|222836771|gb|EEE75164.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255561104|ref|XP_002521564.1| syntaxin, putative [Ricinus communis] gi|223539242|gb|EEF40835.1| syntaxin, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15224138|ref|NP_179417.1| phosphopantetheine adenylyltransferase [Arabidopsis thaliana] gi|75267775|sp|Q9ZPV8.1|COAD_ARATH RecName: Full=Phosphopantetheine adenylyltransferase; AltName: Full=Dephospho-CoA pyrophosphorylase; Short=AtCoaD; AltName: Full=Pantetheine-phosphate adenylyltransferase gi|4309741|gb|AAD15511.1| hypothetical protein [Arabidopsis thaliana] gi|34365611|gb|AAQ65117.1| At2g18250 [Arabidopsis thaliana] gi|51971991|dbj|BAD44660.1| hypothetical protein [Arabidopsis thaliana] gi|330251652|gb|AEC06746.1| phosphopantetheine adenylyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225460271|ref|XP_002278835.1| PREDICTED: phosphopantetheine adenylyltransferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|359476888|ref|XP_002265408.2| PREDICTED: syntaxin-112 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089428|emb|CBI39247.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297735135|emb|CBI17497.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449529337|ref|XP_004171656.1| PREDICTED: phosphopantetheine adenylyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449432834|ref|XP_004134203.1| PREDICTED: phosphopantetheine adenylyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
TAIR|locus:2062165176 COAD "4-phosphopantetheine ade 0.922 0.806 0.809 1.9e-58
WB|WBGene00022031 461 Y65B4A.8 [Caenorhabditis elega 0.831 0.277 0.507 9.5e-28
ZFIN|ZDB-GENE-040912-137 554 coasy "Coenzyme A synthase" [D 0.876 0.243 0.419 4.2e-27
SGD|S000003509305 CAB4 "Probable pantetheine-pho 0.811 0.409 0.425 4.2e-24
MGI|MGI:1918993 563 Coasy "Coenzyme A synthase" [M 0.870 0.238 0.402 1.8e-23
RGD|1549767 563 Coasy "CoA synthase" [Rattus n 0.870 0.238 0.402 1.8e-23
UNIPROTKB|Q8MIR4 562 COASY "Bifunctional coenzyme A 0.870 0.238 0.402 3e-23
UNIPROTKB|Q13057 564 COASY "Bifunctional coenzyme A 0.870 0.237 0.395 3.9e-23
FB|FBgn0035632 518 Ppat-Dpck "Bifunctional Phosph 0.909 0.270 0.414 8.2e-23
UNIPROTKB|E2RIA4 564 COASY "Uncharacterized protein 0.870 0.237 0.395 8.3e-23
TAIR|locus:2062165 COAD "4-phosphopantetheine adenylyltransferase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 600 (216.3 bits), Expect = 1.9e-58, P = 1.9e-58
 Identities = 115/142 (80%), Positives = 130/142 (91%)

Query:    12 NSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELI 71
             +S +SP NS+GAVVLGGTFDRLHDGHR+FLKA+AELARDRIVVGVCDGPMLT KQF+++I
Sbjct:     6 DSKMSPANSFGAVVLGGTFDRLHDGHRMFLKAAAELARDRIVVGVCDGPMLTKKQFSDMI 65

Query:    72 QPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKK 131
             QP++ERMRNVE Y+KSIKPELVVQ EPITDPYGPSIVDENLEAIVVSKETLPGGLSVN+K
Sbjct:    66 QPIEERMRNVETYVKSIKPELVVQAEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNRK 125

Query:   132 RADRGLSQLKVWVPVLVVPSKS 153
             RA+RGLSQLK+ V  +V    S
Sbjct:   126 RAERGLSQLKIEVVEIVSDGSS 147
GO:0003824 "catalytic activity" evidence=IEA
GO:0004140 "dephospho-CoA kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0009058 "biosynthetic process" evidence=IEA;ISS
GO:0015937 "coenzyme A biosynthetic process" evidence=IEA;IDA
GO:0016779 "nucleotidyltransferase activity" evidence=IEA;ISS
GO:0004595 "pantetheine-phosphate adenylyltransferase activity" evidence=IDA
GO:0006629 "lipid metabolic process" evidence=IMP
GO:0006970 "response to osmotic stress" evidence=IMP
GO:0009651 "response to salt stress" evidence=IMP
GO:0019915 "lipid storage" evidence=IMP
GO:0040007 "growth" evidence=IMP
GO:0080020 "regulation of coenzyme A biosynthetic process" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
WB|WBGene00022031 Y65B4A.8 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040912-137 coasy "Coenzyme A synthase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
SGD|S000003509 CAB4 "Probable pantetheine-phosphate adenylyltransferase (PPAT)" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
MGI|MGI:1918993 Coasy "Coenzyme A synthase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1549767 Coasy "CoA synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MIR4 COASY "Bifunctional coenzyme A synthase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q13057 COASY "Bifunctional coenzyme A synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0035632 Ppat-Dpck "Bifunctional Phosphopantetheine adenylyltransferase - Dephospho-CoA kinase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2RIA4 COASY "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8TGY4COAD_METKA2, ., 7, ., 7, ., 30.36150.83110.8152yesno
Q9ZPV8COAD_ARATH2, ., 7, ., 7, ., 30.84960.86360.7556yesno
C5A3G3COAD_THEGJ2, ., 7, ., 7, ., 30.37120.83760.8113yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.7.30.991
3rd Layer2.7.70.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00570163
4-phosphopantetheine adenylyltransferase (EC-2.7.7.3) (178 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XV.1934.1
SubName- Full=Putative uncharacterized protein; (185 aa)
     •• 0.946
fgenesh4_pm.C_LG_X000827
dephospho-CoA kinase (EC-2.7.1.24) (232 aa)
     •• 0.937
estExt_fgenesh4_pg.C_LG_XV0519
pantothenate kinase (EC-2.7.1.33) (872 aa)
     •• 0.918
eugene3.00120751
pantothenate kinase (EC-2.7.1.33) (939 aa)
     •• 0.918
eugene3.80020001
Predicted protein (399 aa)
     •• 0.457
gw1.XVIII.1881.1
hypothetical protein (281 aa)
• •     0.445
estExt_Genewise1_v1.C_LG_XIII0788
hypothetical protein (118 aa)
  •     0.419
gw1.64.350.1
hypothetical protein (339 aa)
• •     0.415
gw1.XIV.2332.1
annotation not avaliable (306 aa)
• •     0.409
estExt_fgenesh4_pm.C_LG_IX0168
RecName- Full=Proteasome subunit alpha type; EC=3.4.25.1;; The proteasome is a multicatalytic p [...] (250 aa)
  •     0.406

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
PLN02388177 PLN02388, PLN02388, phosphopantetheine adenylyltra 1e-92
cd02164143 cd02164, PPAT_CoAS, phosphopantetheine adenylyltra 2e-58
COG1019158 COG1019, COG1019, Predicted nucleotidyltransferase 6e-35
PRK00777153 PRK00777, PRK00777, phosphopantetheine adenylyltra 2e-34
PRK01170 322 PRK01170, PRK01170, phosphopantetheine adenylyltra 5e-18
cd02039143 cd02039, cytidylyltransferase_like, Cytidylyltrans 3e-10
pfam01467148 pfam01467, CTP_transf_2, Cytidylyltransferase 5e-10
TIGR0012566 TIGR00125, cyt_tran_rel, cytidyltransferase-like d 4e-08
COG0615140 COG0615, TagD, Cytidylyltransferase [Cell envelope 5e-05
cd02170136 cd02170, cytidylyltransferase, cytidylyltransferas 1e-04
>gnl|CDD|215218 PLN02388, PLN02388, phosphopantetheine adenylyltransferase Back     alignment and domain information 
 Score =  265 bits (679), Expect = 1e-92
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 1/151 (0%)

Query: 3   MAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPML 62
           M  + +SV +S +SP NSYGAVVLGGTFDRLHDGHRLFLKA+AELARDRIV+GVCDGPML
Sbjct: 1   MVTVKDSVADSKLSPPNSYGAVVLGGTFDRLHDGHRLFLKAAAELARDRIVIGVCDGPML 60

Query: 63  TNKQFAELIQPVDERMRNVEAYIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETL 122
           + KQFAELIQP++ERM NVE YIKSIKPELVVQ EPI DPYGPSIVDENLEAIVVSKETL
Sbjct: 61  SKKQFAELIQPIEERMHNVEEYIKSIKPELVVQAEPIIDPYGPSIVDENLEAIVVSKETL 120

Query: 123 PGGLSVNKKRADRGLSQLKVWVPVLVVPSKS 153
           PGGLSVNKKRA+RGLSQLK+ V V +VP +S
Sbjct: 121 PGGLSVNKKRAERGLSQLKIEV-VDIVPEES 150

Length = 177
>gnl|CDD|173915 cd02164, PPAT_CoAS, phosphopantetheine adenylyltransferase domain of eukaryotic and archaeal bifunctional enzymes Back     alignment and domain information
>gnl|CDD|223950 COG1019, COG1019, Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234834 PRK00777, PRK00777, phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234912 PRK01170, PRK01170, phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|185678 cd02039, cytidylyltransferase_like, Cytidylyltransferase-like domain Back     alignment and domain information
>gnl|CDD|216517 pfam01467, CTP_transf_2, Cytidylyltransferase Back     alignment and domain information
>gnl|CDD|232837 TIGR00125, cyt_tran_rel, cytidyltransferase-like domain Back     alignment and domain information
>gnl|CDD|223688 COG0615, TagD, Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] Back     alignment and domain information
>gnl|CDD|173921 cd02170, cytidylyltransferase, cytidylyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 154
cd02164143 PPAT_CoAS phosphopantetheine adenylyltransferase d 100.0
PLN02388177 phosphopantetheine adenylyltransferase 100.0
COG1019158 Predicted nucleotidyltransferase [General function 100.0
KOG3351293 consensus Predicted nucleotidyltransferase [Genera 100.0
PRK00777153 phosphopantetheine adenylyltransferase; Provisiona 100.0
PRK01170 322 phosphopantetheine adenylyltransferase/unknown dom 100.0
COG1057197 NadD Nicotinic acid mononucleotide adenylyltransfe 99.73
PRK06973243 nicotinic acid mononucleotide adenylyltransferase; 99.71
PRK00071203 nadD nicotinic acid mononucleotide adenylyltransfe 99.67
PRK00168159 coaD phosphopantetheine adenylyltransferase; Provi 99.66
PRK08887174 nicotinic acid mononucleotide adenylyltransferase; 99.66
TIGR00482193 nicotinate (nicotinamide) nucleotide adenylyltrans 99.65
cd02167158 NMNAT_NadR Nicotinamide/nicotinate mononucleotide 99.65
PRK13964140 coaD phosphopantetheine adenylyltransferase; Provi 99.65
PRK07152 342 nadD putative nicotinate-nucleotide adenylyltransf 99.64
TIGR01510155 coaD_prev_kdtB pantetheine-phosphate adenylyltrans 99.64
cd02166163 NMNAT_Archaea Nicotinamide/nicotinate mononucleoti 99.64
cd02168181 NMNAT_Nudix Nicotinamide/nicotinate mononucleotide 99.63
cd02163153 PPAT Phosphopantetheine adenylyltransferase. Phosp 99.62
cd02165192 NMNAT Nicotinamide/nicotinate mononucleotide adeny 99.62
PRK05379 340 bifunctional nicotinamide mononucleotide adenylylt 99.61
TIGR0012566 cyt_tran_rel cytidyltransferase-related domain. Pr 99.61
TIGR01527165 arch_NMN_Atrans nicotinamide-nucleotide adenylyltr 99.6
PF01467157 CTP_transf_2: Cytidylyltransferase; InterPro: IPR0 99.6
PRK13793196 nicotinamide-nucleotide adenylyltransferase; Provi 99.6
cd02039143 cytidylyltransferase_like Cytidylyltransferase-lik 99.6
cd02173152 ECT CTP:phosphoethanolamine cytidylyltransferase ( 99.56
PRK01153174 nicotinamide-nucleotide adenylyltransferase; Provi 99.55
COG0615140 TagD Cytidylyltransferase [Cell envelope biogenesi 99.51
PLN02945236 nicotinamide-nucleotide adenylyltransferase/nicoti 99.5
cd02174150 CCT CTP:phosphocholine cytidylyltransferase. CTP:p 99.5
PLN02406 418 ethanolamine-phosphate cytidylyltransferase 99.5
COG0669159 CoaD Phosphopantetheine adenylyltransferase [Coenz 99.48
cd09286225 NMNAT_Eukarya Nicotinamide/nicotinate mononucleoti 99.43
TIGR01526 325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 99.43
cd02170136 cytidylyltransferase cytidylyltransferase. The cyt 99.39
cd02171129 G3P_Cytidylyltransferase glycerol-3-phosphate cyti 99.39
PTZ00308353 ethanolamine-phosphate cytidylyltransferase; Provi 99.38
COG2870467 RfaE ADP-heptose synthase, bifunctional sugar kina 99.34
cd02156105 nt_trans nucleotidyl transferase superfamily. nt_t 99.33
PLN02413 294 choline-phosphate cytidylyltransferase 99.33
PRK08099 399 bifunctional DNA-binding transcriptional repressor 99.31
PLN02406418 ethanolamine-phosphate cytidylyltransferase 99.27
TIGR01518125 g3p_cytidyltrns glycerol-3-phosphate cytidylyltran 99.25
COG1056172 NadR Nicotinamide mononucleotide adenylyltransfera 99.19
TIGR00124332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 99.16
cd02172144 RfaE_N N-terminal domain of RfaE. RfaE is a protei 99.15
KOG2803 358 consensus Choline phosphate cytidylyltransferase/P 99.15
TIGR02199144 rfaE_dom_II rfaE bifunctional protein, domain II. 99.14
PTZ00308 353 ethanolamine-phosphate cytidylyltransferase; Provi 99.14
PRK11316473 bifunctional heptose 7-phosphate kinase/heptose 1- 98.92
smart00764182 Citrate_ly_lig Citrate lyase ligase C-terminal dom 98.91
cd02169297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 98.86
cd02064180 FAD_synthetase_N FAD synthetase, N-terminal domain 98.76
KOG2803358 consensus Choline phosphate cytidylyltransferase/P 98.75
KOG2804 348 consensus Phosphorylcholine transferase/cholinepho 98.53
PRK13671 298 hypothetical protein; Provisional 98.5
PRK07143 279 hypothetical protein; Provisional 98.11
PRK05627 305 bifunctional riboflavin kinase/FMN adenylyltransfe 98.08
PF06574157 FAD_syn: FAD synthetase; InterPro: IPR015864 Ribof 97.98
PF08218182 Citrate_ly_lig: Citrate lyase ligase C-terminal do 97.78
TIGR00339383 sopT ATP sulphurylase. Members of this family also 97.54
TIGR00083 288 ribF riboflavin kinase/FMN adenylyltransferase. mu 97.46
COG0196 304 RibF FAD synthase [Coenzyme metabolism] 97.37
PRK13670 388 hypothetical protein; Provisional 97.21
PF05636 388 HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPr 97.12
COG3053352 CitC Citrate lyase synthetase [Energy production a 96.8
COG1323 358 Predicted nucleotidyltransferase [General function 96.67
KOG3199 234 consensus Nicotinamide mononucleotide adenylyl tra 96.22
TIGR00018 282 panC pantoate--beta-alanine ligase. This family is 95.63
cd00560 277 PanC Pantoate-beta-alanine ligase. PanC Pantoate-b 95.42
PRK00380 281 panC pantoate--beta-alanine ligase; Reviewed 95.28
PLN02660 284 pantoate--beta-alanine ligase 95.15
PF01747215 ATP-sulfurylase: ATP-sulfurylase; InterPro: IPR002 93.29
cd00517353 ATPS ATP-sulfurylase. ATP-sulfurylase (ATPS), also 92.55
PRK04149391 sat sulfate adenylyltransferase; Reviewed 92.23
COG2046397 MET3 ATP sulfurylase (sulfate adenylyltransferase) 91.98
PF02569 280 Pantoate_ligase: Pantoate-beta-alanine ligase; Int 91.68
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Pr 88.7
COG0414 285 PanC Panthothenate synthetase [Coenzyme metabolism 86.9
PRK05537 568 bifunctional sulfate adenylyltransferase subunit 1 85.99
>cd02164 PPAT_CoAS phosphopantetheine adenylyltransferase domain of eukaryotic and archaeal bifunctional enzymes Back     alignment and domain information 
Probab=100.00  E-value=1.1e-41  Score=257.84  Aligned_cols=128  Identities=47%  Similarity=0.827  Sum_probs=120.5

Q ss_pred             EEEEcccCCCCCHHHHHHHHHHHHHhcCcEEEEEcCCCccccCCCCCCCCCHHHHHHHHHHHHHhcCCCceEEEEEccCC
Q 031699           23 AVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKSIKPELVVQTEPITDP  102 (154)
Q Consensus        23 ~v~~gGtFDplH~GH~~ll~~A~~~~~~~viVgvt~~~~~~~k~~~~~i~~~~~R~~~v~~~l~~~~p~~~v~i~ei~d~  102 (154)
                      .|++|||||++|.||+.+|++|++++.++++||+++++++++|+.+..++|+++|++|++.|++.+.|...+++.+|.|+
T Consensus         1 ~v~~GGtFD~lH~GH~~Ll~~a~~~~~d~v~vgvt~d~~~~~k~~~~~i~s~e~R~~~l~~~l~~~~~~~~~~i~~i~d~   80 (143)
T cd02164           1 KVAVGGTFDRLHDGHKILLSVAFLLAGEKLIIGVTSDELLKNKSLKELIEPYEERIANLHEFLVDLKPTLKYEIVPIDDP   80 (143)
T ss_pred             CEEEcccCCCCCHHHHHHHHHHHHHhcCCcEEEEeCchhcccCCCCCCCCCHHHHHHHHHHHHHhcCCCceEEEEEccCC
Confidence            37899999999999999999999998778999999998776665456789999999999999999988889999999999


Q ss_pred             CCCcccccccceeeehhhhhccHHHHHHHHHHCCCCceeEEEeeeecC
Q 031699          103 YGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQLKVWVPVLVVP  150 (154)
Q Consensus       103 ~gps~t~~~l~~lVvs~Et~~~~~~iN~~R~~~gl~~l~i~~i~~v~~  150 (154)
                      |||+.|++++||||||+||++||.+||++|+++||+||+|++|++|.+
T Consensus        81 ~Gpt~~~~~~d~lVVS~ET~~~~~~iN~~R~~~gl~pl~i~~v~~v~~  128 (143)
T cd02164          81 YGPTGTDPDLEAIVVSPETYPGALKINRKREENGLSPLEIVVVPLVKA  128 (143)
T ss_pred             CCCcccCCCCCEEEEcHHHhhhHHHHHHHHHHCCCCceeEEEEEeecc
Confidence            999999999999999999999999999999999999999999999988

The PPAT domain of the bifunctional enzyme with PPAT and DPCK functions. The final two steps of the CoA biosynthesis pathway are catalyzed by phosphopantetheine adenylyltransferase (PPAT) and dephospho-CoA (dPCoA) kinase (DPCK). The PPAT reaction involves the reversible adenylation of 4'-phosphopantetheine to form 3'-dPCoA and PPi, and DPCK catalyses phosphorylation of the 3'-hydroxy group of the ribose moiety of dPCoA. In eukaryotes the two enzymes are part of a large multienzyme complex . Studies in Corynebacterium ammoniagenes suggested that separate enzymes were present, and this was confirmed through identification of the bacterial PPAT/CoAD.
>PLN02388 phosphopantetheine adenylyltransferase Back     alignment and domain information
>COG1019 Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>KOG3351 consensus Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>PRK00777 phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>PRK01170 phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG1057 NadD Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK06973 nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK00071 nadD nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK00168 coaD phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>PRK08887 nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>TIGR00482 nicotinate (nicotinamide) nucleotide adenylyltransferase Back     alignment and domain information
>cd02167 NMNAT_NadR Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional NadR-like proteins Back     alignment and domain information
>PRK13964 coaD phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>PRK07152 nadD putative nicotinate-nucleotide adenylyltransferase; Validated Back     alignment and domain information
>TIGR01510 coaD_prev_kdtB pantetheine-phosphate adenylyltransferase, bacterial Back     alignment and domain information
>cd02166 NMNAT_Archaea Nicotinamide/nicotinate mononucleotide adenylyltransferase, archaeal Back     alignment and domain information
>cd02168 NMNAT_Nudix Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional proteins, also containing a Nudix hydrolase domain Back     alignment and domain information
>cd02163 PPAT Phosphopantetheine adenylyltransferase Back     alignment and domain information
>cd02165 NMNAT Nicotinamide/nicotinate mononucleotide adenylyltransferase Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>TIGR00125 cyt_tran_rel cytidyltransferase-related domain Back     alignment and domain information
>TIGR01527 arch_NMN_Atrans nicotinamide-nucleotide adenylyltransferase Back     alignment and domain information
>PF01467 CTP_transf_2: Cytidylyltransferase; InterPro: IPR004820 This family includes []: Cholinephosphate cytidyltransferase (P49585 from SWISSPROT) Back     alignment and domain information
>PRK13793 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>cd02039 cytidylyltransferase_like Cytidylyltransferase-like domain Back     alignment and domain information
>cd02173 ECT CTP:phosphoethanolamine cytidylyltransferase (ECT) Back     alignment and domain information
>PRK01153 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>COG0615 TagD Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] Back     alignment and domain information
>PLN02945 nicotinamide-nucleotide adenylyltransferase/nicotinate-nucleotide adenylyltransferase Back     alignment and domain information
>cd02174 CCT CTP:phosphocholine cytidylyltransferase Back     alignment and domain information
>PLN02406 ethanolamine-phosphate cytidylyltransferase Back     alignment and domain information
>COG0669 CoaD Phosphopantetheine adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>cd09286 NMNAT_Eukarya Nicotinamide/nicotinate mononucleotide adenylyltransferase, Eukaryotic Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>cd02170 cytidylyltransferase cytidylyltransferase Back     alignment and domain information
>cd02171 G3P_Cytidylyltransferase glycerol-3-phosphate cytidylyltransferase Back     alignment and domain information
>PTZ00308 ethanolamine-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02156 nt_trans nucleotidyl transferase superfamily Back     alignment and domain information
>PLN02413 choline-phosphate cytidylyltransferase Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PLN02406 ethanolamine-phosphate cytidylyltransferase Back     alignment and domain information
>TIGR01518 g3p_cytidyltrns glycerol-3-phosphate cytidylyltransferase Back     alignment and domain information
>COG1056 NadR Nicotinamide mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>cd02172 RfaE_N N-terminal domain of RfaE Back     alignment and domain information
>KOG2803 consensus Choline phosphate cytidylyltransferase/Predicted CDP-ethanolamine synthase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02199 rfaE_dom_II rfaE bifunctional protein, domain II Back     alignment and domain information
>PTZ00308 ethanolamine-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional Back     alignment and domain information
>smart00764 Citrate_ly_lig Citrate lyase ligase C-terminal domain Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>cd02064 FAD_synthetase_N FAD synthetase, N-terminal domain of the bifunctional enzyme Back     alignment and domain information
>KOG2803 consensus Choline phosphate cytidylyltransferase/Predicted CDP-ethanolamine synthase [Lipid transport and metabolism] Back     alignment and domain information
>KOG2804 consensus Phosphorylcholine transferase/cholinephosphate cytidylyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>PRK13671 hypothetical protein; Provisional Back     alignment and domain information
>PRK07143 hypothetical protein; Provisional Back     alignment and domain information
>PRK05627 bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed Back     alignment and domain information
>PF06574 FAD_syn: FAD synthetase; InterPro: IPR015864 Riboflavin is converted into catalytically active cofactors (FAD and FMN) by the actions of riboflavin kinase (2 Back     alignment and domain information
>PF08218 Citrate_ly_lig: Citrate lyase ligase C-terminal domain; InterPro: IPR013166 [Citrate (pro-3S)-lyase] ligase (6 Back     alignment and domain information
>TIGR00339 sopT ATP sulphurylase Back     alignment and domain information
>TIGR00083 ribF riboflavin kinase/FMN adenylyltransferase Back     alignment and domain information
>COG0196 RibF FAD synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK13670 hypothetical protein; Provisional Back     alignment and domain information
>PF05636 HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPro: IPR008513 This family consists of several bacterial proteins of unknown function Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>COG1323 Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>KOG3199 consensus Nicotinamide mononucleotide adenylyl transferase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00018 panC pantoate--beta-alanine ligase Back     alignment and domain information
>cd00560 PanC Pantoate-beta-alanine ligase Back     alignment and domain information
>PRK00380 panC pantoate--beta-alanine ligase; Reviewed Back     alignment and domain information
>PLN02660 pantoate--beta-alanine ligase Back     alignment and domain information
>PF01747 ATP-sulfurylase: ATP-sulfurylase; InterPro: IPR002650 This entry consists of sulphate adenylyltransferase or ATP-sulfurylase (2 Back     alignment and domain information
>cd00517 ATPS ATP-sulfurylase Back     alignment and domain information
>PRK04149 sat sulfate adenylyltransferase; Reviewed Back     alignment and domain information
>COG2046 MET3 ATP sulfurylase (sulfate adenylyltransferase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF02569 Pantoate_ligase: Pantoate-beta-alanine ligase; InterPro: IPR003721 D-Pantothenate is synthesized via four enzymes from ketoisovalerate, which is an intermediate of branched-chain amino acid synthesis [] Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>COG0414 PanC Panthothenate synthetase [Coenzyme metabolism] Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
3do8_A148 The Crystal Structure Of The Protein With Unknown F 2e-10
>pdb|3DO8|A Chain A, The Crystal Structure Of The Protein With Unknown Function From Archaeoglobus Fulgidus Length = 148 Back     alignment and structure 
Iteration: 1

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 65/122 (53%), Gaps = 10/122 (8%)
Query: 24  VVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEA 83
           V LGGTF+ LH+GH+  +  + +L    I +GV    M   +  + L  P   R  NV+ 
Sbjct: 3   VALGGTFEPLHEGHKKLIDVAIKLGGRDITIGVTSDRMARARIRSVL--PFAIRAENVKR 60
Query: 84  YI---KSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQL 140
           Y+      +PE+V     IT+PYG ++ D + E +VVS ET    L +N+KR + G  ++
Sbjct: 61  YVMRKYGFEPEIV----KITNPYGKTL-DVDFEYLVVSPETYEMALKINQKREELGKRKI 115
Query: 141 KV 142
            +
Sbjct: 116 TI 117

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
3do8_A148 Phosphopantetheine adenylyltransferase; protein wi 7e-35
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 4e-06
2b7l_A132 Glycerol-3-phosphate cytidylyltransferase; rossman 5e-05
3elb_A341 Ethanolamine-phosphate cytidylyltransferase; kenne 9e-05
1coz_A129 Protein (glycerol-3-phosphate cytidylyltransferase 2e-04
3hl4_A236 Choline-phosphate cytidylyltransferase A; rossmann 3e-04
>3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Length = 148 Back     alignment and structure
 Score =  117 bits (295), Expect = 7e-35
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 4/121 (3%)

Query: 24  VVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEA 83
           V LGGTF+ LH+GH+  +  + +L    I +GV    M   +  +    P   R  NV+ 
Sbjct: 3   VALGGTFEPLHEGHKKLIDVAIKLGGRDITIGVTSDRMARARIRSV--LPFAIRAENVKR 60

Query: 84  YIKSIKPELVVQTEPITDPYGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQLKVW 143
           Y+   K     +   IT+PYG ++ D + E +VVS ET    L +N+KR + G  ++ + 
Sbjct: 61  YVMR-KYGFEPEIVKITNPYGKTL-DVDFEYLVVSPETYEMALKINQKREELGKRKITIV 118

Query: 144 V 144
            
Sbjct: 119 K 119
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Length = 365 Back     alignment and structure
>2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} Length = 132 Back     alignment and structure
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Length = 341 Back     alignment and structure
>1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* Length = 129 Back     alignment and structure
>3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} Length = 236 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
3do8_A148 Phosphopantetheine adenylyltransferase; protein wi 100.0
3h05_A177 Uncharacterized protein VPA0413; nucleotidylyl, tr 99.68
1vlh_A173 Phosphopantetheine adenylyltransferase; TM0741, st 99.64
3nbk_A177 Phosphopantetheine adenylyltransferase; PPAT, PHP; 99.64
3nd5_A171 Phosphopantetheine adenylyltransferase; PPAT, coen 99.64
3nv7_A157 Phosphopantetheine adenylyltransferase; helicobact 99.63
3f3m_A168 Phosphopantetheine adenylyltransferase; PPAT, coen 99.63
1yum_A242 'probable nicotinate-nucleotide adenylyltransferas 99.62
4f3r_A162 Phosphopantetheine adenylyltransferase; phosphopan 99.62
2h29_A189 Probable nicotinate-nucleotide adenylyltransferase 99.61
2qjt_B 352 Nicotinamide-nucleotide adenylyltransferase; two i 99.6
2qtr_A189 Nicotinate (nicotinamide) nucleotide adenylyltran; 99.59
1kam_A194 Deamido-NAD(+), nicotinate-nucleotide adenylyltran 99.59
1k4m_A213 NAMN adenylyltransferase; nucleotidyltransferase; 99.57
3glv_A143 Lipopolysaccharide core biosynthesis protein; stru 99.56
1nup_A 252 FKSG76; NAD biosynthesis, mitochondria, pyridine a 99.54
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 99.54
1o6b_A169 Phosphopantetheine adenylyltransferase; structural 99.54
1qjc_A158 Phosphopantetheine adenylyltransferase; coenzyme A 99.53
3k9w_A187 Phosphopantetheine adenylyltransferase; niaid, ssg 99.53
1od6_A160 PPAT, phosphopantetheine adenylyltransferase; coen 99.48
1kqn_A 279 Nmnat, nicotinamide mononucleotide adenylyl transf 99.48
2b7l_A132 Glycerol-3-phosphate cytidylyltransferase; rossman 99.48
1coz_A129 Protein (glycerol-3-phosphate cytidylyltransferase 99.47
1f9a_A168 Hypothetical protein MJ0541; alpha/beta, transfera 99.45
3hl4_A236 Choline-phosphate cytidylyltransferase A; rossmann 99.42
1ej2_A181 Nicotinamide mononucleotide adenylyltransferase; d 99.39
3elb_A341 Ethanolamine-phosphate cytidylyltransferase; kenne 99.38
2qjo_A 341 Bifunctional NMN adenylyltransferase/nudix hydrol; 99.34
3elb_A 341 Ethanolamine-phosphate cytidylyltransferase; kenne 99.32
1jhd_A396 Sulfate adenylyltransferase; sulfurylase, APS, che 98.64
1v47_A349 ATP sulfurylase; product binding complex, zinc, ri 98.51
2x0k_A 338 Riboflavin biosynthesis protein RIBF; riboflavin k 98.48
1mrz_A 293 Riboflavin kinase/FMN adenylyltransferase; rossman 98.41
2ejc_A 280 Pantoate--beta-alanine ligase; X-RAY diffraction, 98.28
3op1_A 308 Macrolide-efflux protein; structural genomics, PSI 98.11
3gmi_A 357 UPF0348 protein MJ0951; protein with unknown funct 98.02
1v8f_A 276 Pantoate-beta-alanine ligase; rossmann fold, dimer 97.34
3ag6_A 283 Pantothenate synthetase; ATP-dependent enzyme, ATP 95.8
1r6x_A395 ATP:sulfate adenylyltransferase; APS kinase-like d 95.48
1g8f_A 511 Sulfate adenylyltransferase; alpha-beta protein, b 95.42
3q12_A 287 Pantoate--beta-alanine ligase; structural genomics 95.23
3cov_A 301 Pantothenate synthetase; pantothenate biosynthesis 95.01
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfuryl 94.87
3uk2_A 283 Pantothenate synthetase; AMP, structural genomics, 94.73
3inn_A 314 Pantothenate synthetase; ssgcid, SBRI, UW, decode, 94.57
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosph 93.92
3mxt_A 285 Pantothenate synthetase; alpha-beta-alpha, structu 90.76
3n8h_A 264 Pantothenate synthetase; alpha-beta sandwich, liga 89.96
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 89.48
1x6v_B630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 81.76
>3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Back     alignment and structure
Probab=100.00  E-value=2.9e-33  Score=211.51  Aligned_cols=123  Identities=30%  Similarity=0.518  Sum_probs=111.7

Q ss_pred             EEEEcccCCCCCHHHHHHHHHHHHHhcCcEEEEEcCCCccccCCCCCCCCCHHHHHHHHHHHH-HhcCCCceEEEEEccC
Q 031699           23 AVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYI-KSIKPELVVQTEPITD  101 (154)
Q Consensus        23 ~v~~gGtFDplH~GH~~ll~~A~~~~~~~viVgvt~~~~~~~k~~~~~i~~~~~R~~~v~~~l-~~~~p~~~v~i~ei~d  101 (154)
                      ++++||||||+|.||+.++++|++++.|+|+|++++++..+++  ..+++|+++|++|++.++ +.+++  ++.+.+|.|
T Consensus         2 ~~i~gGtFDPiH~GHl~l~~~a~~~~~d~viv~v~~~~~~~k~--~~~~~~~~~R~~ml~~a~~~~~~~--~~~i~~i~D   77 (148)
T 3do8_A            2 KVALGGTFEPLHEGHKKLIDVAIKLGGRDITIGVTSDRMARAR--IRSVLPFAIRAENVKRYVMRKYGF--EPEIVKITN   77 (148)
T ss_dssp             CEEEEECCSSCCHHHHHHHHHHHHHHTTCEEEEEECHHHHHHH--SCCCSCHHHHHHHHHHHHHHHHSS--CCEEEEECS
T ss_pred             EEEEEeeCCCCCHHHHHHHHHHHHhCCCEEEEEECCCcccccc--CCCCCCHHHHHHHHHHHHhcccCC--cEEEEeecC
Confidence            6899999999999999999999999768999999998876322  357899999999999999 88754  788999999


Q ss_pred             CCCCcccccccceeeehhhhhccHHHHHHHHHHCCCCceeEEEeeeecC
Q 031699          102 PYGPSIVDENLEAIVVSKETLPGGLSVNKKRADRGLSQLKVWVPVLVVP  150 (154)
Q Consensus       102 ~~gps~t~~~l~~lVvs~Et~~~~~~iN~~R~~~gl~~l~i~~i~~v~~  150 (154)
                      +|||+. ++++|+||||+||+.++..+|++|.++|++||++++|+.+..
T Consensus        78 ~~g~~~-~~~~d~ivvs~Et~~~~~~l~~~~~~~G~~~l~V~~v~~~~~  125 (148)
T 3do8_A           78 PYGKTL-DVDFEYLVVSPETYEMALKINQKREELGKRKITIVKVDWMMA  125 (148)
T ss_dssp             TTTTTT-TSCCSEEEECTTTHHHHHHHHHHHHHHTCCCCEEEEEECCC-
T ss_pred             CCCCCC-CCCCCEEEEChhhcccHHHHHHHHHHcCCCeeEEEEeccEEc
Confidence            999996 699999999999999999999999999999999999999865
>3h05_A Uncharacterized protein VPA0413; nucleotidylyl, transferase, MCSG, midwest center for structu genomics, PSI; 1.65A {Vibrio parahaemolyticus} Back     alignment and structure
>1vlh_A Phosphopantetheine adenylyltransferase; TM0741, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: PNS; 2.20A {Thermotoga maritima} SCOP: c.26.1.3 Back     alignment and structure
>3nbk_A Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: PNS; 1.58A {Mycobacterium tuberculosis} PDB: 3nba_A* 3pnb_A* 4e1a_A 3lcj_A 3rba_A* 1tfu_A* 3rff_A 3rhs_A* 3uc5_A* Back     alignment and structure
>3nd5_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway; 2.30A {Enterococcus faecalis} SCOP: c.26.1.0 PDB: 3nd6_A* 3nd7_A* Back     alignment and structure
>3nv7_A Phosphopantetheine adenylyltransferase; helicobacter pylori 26695 strain, mutant I4V/N76Y, phosphopa adenylyltransferase; 1.75A {Helicobacter pylori} PDB: 3otw_A* Back     alignment and structure
>3f3m_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway, coenzyme A biosynthesis, nucleotidyltransferase; HET: PPS; 2.40A {Staphylococcus aureus} SCOP: c.26.1.0 Back     alignment and structure
>1yum_A 'probable nicotinate-nucleotide adenylyltransferase; alpha/beta domain; HET: CIT NCN; 1.70A {Pseudomonas aeruginosa} PDB: 1yul_A* 1yun_A* Back     alignment and structure
>4f3r_A Phosphopantetheine adenylyltransferase; phosphopantetheine adenylyltranferase; 2.25A {Coxiella burnetii} Back     alignment and structure
>2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>2qtr_A Nicotinate (nicotinamide) nucleotide adenylyltran; NAD, nucleotidyltransferase, pyridine nucleotide biosynthesi transferase; HET: NXX; 1.70A {Bacillus anthracis} PDB: 3dv2_A 3mla_A* 3hfj_A* 3mlb_A* 3mmx_A* 3e27_A* 2qtn_A* 2qtm_A* Back     alignment and structure
>1kam_A Deamido-NAD(+), nicotinate-nucleotide adenylyltransferase; rossman fold; 2.10A {Bacillus subtilis} SCOP: c.26.1.3 PDB: 1kaq_A* Back     alignment and structure
>1k4m_A NAMN adenylyltransferase; nucleotidyltransferase; HET: NAD CIT; 1.90A {Escherichia coli} SCOP: c.26.1.3 PDB: 1k4k_A* Back     alignment and structure
>3glv_A Lipopolysaccharide core biosynthesis protein; structural GEN PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} Back     alignment and structure
>1nup_A FKSG76; NAD biosynthesis, mitochondria, pyridine adenylyltransferase catalysis, transferase; HET: NMN; 1.90A {Homo sapiens} SCOP: c.26.1.3 PDB: 1nuq_A* 1nur_A 1nus_A* 1nut_A* 1nuu_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1o6b_A Phosphopantetheine adenylyltransferase; structural genomics; HET: ADP; 2.20A {Bacillus subtilis} SCOP: c.26.1.3 Back     alignment and structure
>1qjc_A Phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.64A {Escherichia coli} SCOP: c.26.1.3 PDB: 1h1t_A* 1gn8_A* 1b6t_A* 3l92_A* 3l93_A Back     alignment and structure
>3k9w_A Phosphopantetheine adenylyltransferase; niaid, ssgcid, seattle structural genomics center for infect disease, coenzyme A, COA; HET: 4PS ADE PG4; 1.60A {Burkholderia pseudomallei} PDB: 3ikz_A* 3pxu_A* Back     alignment and structure
>1od6_A PPAT, phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.5A {Thermus thermophilus} SCOP: c.26.1.3 Back     alignment and structure
>1kqn_A Nmnat, nicotinamide mononucleotide adenylyl transferase; nucleotidyltransferase superfamily; HET: NAD; 2.20A {Homo sapiens} SCOP: c.26.1.3 PDB: 1kqo_A* 1kr2_A* 1kku_A 1gzu_A* Back     alignment and structure
>2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} Back     alignment and structure
>1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* Back     alignment and structure
>1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 Back     alignment and structure
>3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} Back     alignment and structure
>1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* Back     alignment and structure
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Back     alignment and structure
>1jhd_A Sulfate adenylyltransferase; sulfurylase, APS, chemoautotroph, bromide; 1.70A {Sulfur-oxidizing endosymbiont ofriftia pachyptila} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>1v47_A ATP sulfurylase; product binding complex, zinc, riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; HET: ADX; 2.49A {Thermus thermophilus} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>2x0k_A Riboflavin biosynthesis protein RIBF; riboflavin kinase, nucleotide-binding, transferase, ATP-BIND multifunctional enzyme; 1.95A {Corynebacterium ammoniagenes} Back     alignment and structure
>1mrz_A Riboflavin kinase/FMN adenylyltransferase; rossmann fold, flavin binding domain, 6-stranded beta barrel nucleotide binding domain; HET: CIT; 1.90A {Thermotoga maritima} SCOP: b.43.5.1 c.26.1.3 PDB: 1s4m_A* 1t6x_A* 1t6y_A* 1t6z_A* 2i1l_A Back     alignment and structure
>2ejc_A Pantoate--beta-alanine ligase; X-RAY diffraction, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Thermotoga maritima} Back     alignment and structure
>3op1_A Macrolide-efflux protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PEG; 2.49A {Streptococcus pneumoniae} Back     alignment and structure
>3gmi_A UPF0348 protein MJ0951; protein with unknown function, structural genomics, PSI, MCS protein structure initiative; 1.91A {Methanocaldococcus jannaschii} Back     alignment and structure
>1v8f_A Pantoate-beta-alanine ligase; rossmann fold, dimer, structural genomics, riken STR genomics/proteomics initiative, RSGI; HET: P6G; 1.90A {Thermus thermophilus} SCOP: c.26.1.4 PDB: 1ufv_A Back     alignment and structure
>3ag6_A Pantothenate synthetase; ATP-dependent enzyme, ATP-binding, nucleotide-binding, pantothenate biosynthesis; HET: PAJ PG4; 1.85A {Staphylococcus aureus} PDB: 3ag5_A* 2x3f_A* Back     alignment and structure
>1r6x_A ATP:sulfate adenylyltransferase; APS kinase-like domain; 1.40A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3q12_A Pantoate--beta-alanine ligase; structural genomics, center for structural genomics of infec diseases, csgid; HET: PAF; 1.58A {Yersinia pestis} SCOP: c.26.1.4 PDB: 3q10_A* 3mue_A 1iho_A 3guz_A* Back     alignment and structure
>3cov_A Pantothenate synthetase; pantothenate biosynthesis, enzym ligase, drug design, ATP-binding, magnesium, metal-binding; 1.50A {Mycobacterium tuberculosis} SCOP: c.26.1.4 PDB: 3cow_A* 3coy_A* 3coz_A* 3imc_A* 3ime_A* 3img_A* 3iob_A* 3ioc_A* 3iod_A* 3ioe_A* 3iub_A* 3iue_A* 3ivc_A* 3ivg_A* 3ivx_A* 2a84_A* 1n2b_A* 1n2e_A* 1n2g_A* 1n2h_A* ... Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3uk2_A Pantothenate synthetase; AMP, structural genomics, seattle S genomics center for infectious disease, ssgcid, ligase; HET: AMP; 2.25A {Burkholderia thailandensis} SCOP: c.26.1.0 Back     alignment and structure
>3inn_A Pantothenate synthetase; ssgcid, SBRI, UW, decode, NIH, niaid, pantoate beta alanine ligase, ATP-binding, cytoplasm, ligase; HET: ATP; 2.10A {Brucella melitensis} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3mxt_A Pantothenate synthetase; alpha-beta-alpha, structural genomics, center for structural of infectious diseases, csgid, ligase; HET: MSE; 1.85A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3uy4_A* Back     alignment and structure
>3n8h_A Pantothenate synthetase; alpha-beta sandwich, ligase, structural genomics, structural of infectious diseases; HET: MSE AMP GOL; 2.00A {Francisella tularensis subsp} PDB: 3qtt_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 154
d1lw7a1163 c.26.1.3 (A:57-219) Transcriptional regulator NadR 5e-07
d1k4ma_213 c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad 9e-05
d1kama_189 c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad 3e-04
d1ej2a_167 c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad 8e-04
d1f9aa_164 c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad 0.001
>d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} Length = 163 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Adenylyltransferase
domain: Transcriptional regulator NadR, NMN-adenylyltransferase domain
species: Haemophilus influenzae [TaxId: 727]

 Score = 44.4 bits (104), Expect = 5e-07
 Identities = 17/75 (22%), Positives = 32/75 (42%), Gaps = 5/75 (6%)

Query: 24 VVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFA----ELIQPVDERMR 79
           V+ G F  +H GH   +  +     D + V VC   +   K F     + +  V +R+R
Sbjct: 5  GVIFGKFYPVHTGHINMIYEAFSKV-DELHVIVCSDTVRDLKLFYDSKMKRMPTVQDRLR 63

Query: 80 NVEAYIKSIKPELVV 94
           ++   K  K ++ +
Sbjct: 64 WMQQIFKYQKNQIFI 78
>d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]} Length = 213 Back     information, alignment and structure
>d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 189 Back     information, alignment and structure
>d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 167 Back     information, alignment and structure
>d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 164 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
d1coza_126 CTP:glycerol-3-phosphate cytidylyltransferase {Bac 99.62
d1f9aa_164 Nicotinamide mononucleotide (NMN) adenylyltransfer 99.6
d1ej2a_167 Nicotinamide mononucleotide (NMN) adenylyltransfer 99.57
d1kr2a_ 271 Nicotinamide mononucleotide (NMN) adenylyltransfer 99.56
d1o6ba_163 Phosphopantetheine adenylyltransferase {Bacillus s 99.48
d1lw7a1163 Transcriptional regulator NadR, NMN-adenylyltransf 99.47
d1qjca_157 Phosphopantetheine adenylyltransferase {Escherichi 99.43
d1nuua_233 Cytosolic NMN/NAMN adenylyltransferase {Human (Hom 99.42
d1od6a_160 Phosphopantetheine adenylyltransferase {Thermus th 99.36
d1kama_189 Nicotinamide mononucleotide (NMN) adenylyltransfer 99.35
d1tfua_157 Phosphopantetheine adenylyltransferase {Mycobacter 99.35
d1jhda2223 ATP sulfurylase catalytic domain {Sulfur-oxidizing 99.33
d1vlha_157 Phosphopantetheine adenylyltransferase {Thermotoga 99.33
d1k4ma_213 Nicotinamide mononucleotide (NMN) adenylyltransfer 99.22
d1mrza2157 FMN adenylyltransferase domain of bifunctional FAD 98.17
d1v47a2214 ATP sulfurylase catalytic domain {Thermus thermoph 94.51
d1g8fa2221 ATP sulfurylase catalytic domain {Baker's yeast (S 93.77
d1v8fa_ 276 Pantothenate synthetase (Pantoate-beta-alanine lig 92.32
d1ihoa_ 282 Pantothenate synthetase (Pantoate-beta-alanine lig 88.39
d2a84a1 286 Pantothenate synthetase (Pantoate-beta-alanine lig 86.21
d1x6va2235 ATP sulfurylase catalytic domain {Human (Homo sapi 81.03
>d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Cytidylyltransferase
domain: CTP:glycerol-3-phosphate cytidylyltransferase
species: Bacillus subtilis [TaxId: 1423]

Probab=99.62  E-value=7.5e-17  Score=115.96  Aligned_cols=61  Identities=30%  Similarity=0.389  Sum_probs=53.9

Q ss_pred             CcEEEEcccCCCCCHHHHHHHHHHHHHhcCcEEEEEcCCCccccCCCCCCCCCHHHHHHHHHH
Q 031699           21 YGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEA   83 (154)
Q Consensus        21 ~~~v~~gGtFDplH~GH~~ll~~A~~~~~~~viVgvt~~~~~~~k~~~~~i~~~~~R~~~v~~   83 (154)
                      |++|+++|+||++|.||+.+|++|+++| ++|+||+++|+....++ ..|++|+++|.++++.
T Consensus         1 Mk~V~~~G~FD~lH~GH~~~l~~Ak~~g-d~liV~v~sD~~~~~~k-~~pi~~~~eR~~~l~~   61 (126)
T d1coza_           1 MKKVITYGTFDLLHWGHIKLLERAKQLG-DYLVVAISTDEFNLQKQ-KKAYHSYEHRKLILET   61 (126)
T ss_dssp             CCEEEEEECCCSCCHHHHHHHHHHHTTS-SEEEEEEECHHHHHHHT-CCCSSCHHHHHHHHTT
T ss_pred             CcEEEEeeEeCCCCHHHHHHHHHHHhhC-ceeeeeeeccchhhhcc-CcccCCHHHHHHHhhh
Confidence            6799999999999999999999999998 89999999987765443 3689999999999864
>d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kr2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ba_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qjca_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nuua_ c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]} Back     information, alignment and structure
>d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tfua_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jhda2 c.26.1.5 (A:174-396) ATP sulfurylase catalytic domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} Back     information, alignment and structure
>d1vlha_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mrza2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v47a2 c.26.1.5 (A:136-349) ATP sulfurylase catalytic domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8fa2 c.26.1.5 (A:169-389) ATP sulfurylase catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v8fa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ihoa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a84a1 c.26.1.4 (A:3-288) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1x6va2 c.26.1.5 (A:390-624) ATP sulfurylase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure