Citrus Sinensis ID: 031704

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MASSTSQQEFDYLFKLLLIGDSGVGKSTLLLSFTSDTFEELSPTIGVDFKIKHVALGGKKMKLAIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLADIWAKEIDLYSTNQDCIKLLVGNKVDKVCPWRLFLSGFWHFLLSKFYCSS
cccccccccccEEEEEEEECcccccccEEEEEcccccccccccCEEEEEEEEEEEEccEEEEEEEEEccccccccccHHHHcccccEEEEEEEccccHHHHHHHHHHHHHHHHHccccccEEEEEECccccccccEECHHHHHHHHHHcccccc
*********FDYLFKLLLIGDSGVGKSTLLLSFTSDTFEELSPTIGVDFKIKHVALGGKKMKLAIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLADIWAKEIDLYSTNQDCIKLLVGNKVDKVCPWRLFLSGFWHFLLSKFYCS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSTSQQEFDYLFKLLLIGDSGVGKSTLLLSFTSDTFEELSPTIGVDFKIKHVALGGKKMKLAIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLADIWAKEIDLYSTNQDCIKLLVGNKVDKVCPWRLFLSGFWHFLLSKFYCSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein RABC1 Intracellular vesicle trafficking and protein transport.probableO23657
GTP-binding protein ypt1 Protein transport. Probably involved in vesicular traffic.probableP11620
Ras-related protein Rab-1A Probably required for transit of protein from the ER through Golgi compartment. Binds GTP and GDP and possesses intrinsic GTPase activity.probableP62822

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TKL, chain A
Confidence level:very confident
Coverage over the Query: 8-139
View the alignment between query and template
View the model in PyMOL