Citrus Sinensis ID: 031733

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---

MAPKVDSSKKGDPKAQATKVAKAVKSGPTFKKKAKKMRTSVTFHRPKTLKKDRNPKYPRISAPPRNKLDHYQILKYPLTTESAMKKIEDNNTLVFIVDIRADKRKIKDAVKKMYEIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII

cccccccccccccHHHHHHHHHHHHcccccccEEEcccccccccccccccccccccccccccccccccccHHHHHcccccHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHcccccEEEEcccccccEEEEEEccccccHHHHHHHcccc

***********************************KMRTSVTFHRPKT**************PPRNKLDHYQILKYPLTTESAMKKIEDNNTLVFIVDIRADKRKIKDAVKKMYEIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAPKVDSSKKGDPKAQATKVAKAVKSGPTFKKKAKKMRTSVTFHRPKTLKKDRNPKYPRISAPPRNKLDHYQILKYPLTTESAMKKIEDNNTLVFIVDIRADKRKIKDAVKKMYEIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
60S ribosomal protein L23a-2	Binds to a specific region on the 26S rRNA.	confident	Q9M3C3
60S ribosomal protein L23a	This protein binds to a specific region on the 26S rRNA.	probable	Q24JY1
60S ribosomal protein L23a	This protein binds to a specific region on the 26S rRNA.	probable	P62752

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain s
Confidence level:very confident
Coverage over the Query: 73-150
View the alignment between query and template
View the model in PyMOL