Citrus Sinensis ID: 031747

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MKLIFLGSSFSIVWYMRHHSIVRRSYNKDQDTFRRFFLVLPCLLLALLINENFTFKEVMWTFSLYLEAVAILPQLVLLQRTRNIDNLTGQYVFFLGAYRGLYILNWVYRYFTELHYVHWIPWISGLVQTLLYADFFYYYFDSWKNNKNLRLPA
cCEEEHHHHHHHHHHHHccccccccccccccccEEEEEHHHHHEEEEEEccccccccHHHHHHHHHHHHHHHHEEEEEHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEHHHHHHHHHHHHHEEEEEEEEcccEEEccc
MKLIFLGSSFSIVWYMRHHSIVRRSYNKDQDTFRRFFLVLPCLLLALLINENFTFKEVMWTFSLYLEAVAILPQLVLLQRTRNIDNLTGQYVFFLGAYRGLYILNWVYRYFTELHYVHWIPWISGLVQTLLYADFFYYYFDSWKNNKNLRLP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLIFLGSSFSIVWYMRHHSIVRRSYNKDQDTFRRFFLVLPCLLLALLINENFTFKEVMWTFSLYLEAVAILPQLVLLQRTRNIDNLTGQYVFFLGAYRGLYILNWVYRYFTELHYVHWIPWISGLVQTLLYADFFYYYFDSWKNNKNLRLPA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ER lumen protein retaining receptor Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi.probableO76767
ER lumen protein retaining receptor Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi.probableP48583
ER lumen protein retaining receptor Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi. This receptor recognizes H-D-E-L.probableQ9ZTN2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted