Citrus Sinensis ID: 031789

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MYPVEKNRFQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKIIATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDCSLGNKAFYEKCGLKQKGIHMTMYFV
cccccccccEEEEccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHccccEEEEEEEEcccccEEEEEEEEEEEccccccCEEEEEEEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHcccEEccEEEEEEcc
****EKNRFQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKIIATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDCSLGNKAFYEKCGLKQKGIHMTMYFV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYPVEKNRFQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKIIATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDCSLGNKAFYEKCGLKQKGIHMTMYFV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glucosamine 6-phosphate N-acetyltransferase Acetyltransferase involved in UDP-N-acetylglucosamine (UDP-GlcNAc) biosynthesis. UDP-GlcNAc is an essential metabolite that serves as an initial sugar donor of N-glycan synthesis and thus plays an important role in protein and lipid glycosylation.probableQ9LFU9
Glucosamine 6-phosphate N-acetyltransferase 1 probableQ54WR8
Glucosamine 6-phosphate N-acetyltransferase 1 Acetyltransferase involved in de novo biosynthesis of UDP-N-acetylglucosamine (UDP-GlcNAc) in roots and is required for maintaining normal root cell shape. UDP-GlcNAc is an essential metabolite that serves as an initial sugar donor of N-glycan synthesis and thus plays an important role in protein and lipid glycosylation.probableQ5U9F2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable
2.3.1.4Glucosamine-phosphate N-acetyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T90, chain A
Confidence level:very confident
Coverage over the Query: 7-153
View the alignment between query and template
View the model in PyMOL