Citrus Sinensis ID: 031789

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MYPVEKNRFQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKIIATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDCSLGNKAFYEKCGLKQKGIHMTMYFV
cccccccccEEEEccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHccccEEEEEEEEcccccEEEEEEEEEEEccccccEEEEEEEEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHcccEEccEEEEEEcc
cccccccccEEEcccHcHHHccHHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEEEEEccccEEEEEEEEEEEEccHHHHcEEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHcccEEEEEEEEEEEc
MYPVEKNRFQVRKLEITDKSKGFIELLQQLsvcdsvsdKQFEERFLELNsygddhivcvieddrsgkiiatgSIFIEKKFLRncgkvghiEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDcslgnkafyekcglkqkgihmtmyfv
mypveknrfqvrkleitdkSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKIIATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDCSLGNKAFYEkcglkqkgihmtmyfv
MYPVEKNRFQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKIIATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDCSLGNKAFYEKCGLKQKGIHMTMYFV
***********RKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKIIATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDCSLGNKAFYEKCGLKQKGIHMTMYF*
****EKNRFQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKIIATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDCSLGNKAFYEKCGLKQKGIHMTMYFV
MYPVEKNRFQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKIIATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDCSLGNKAFYEKCGLKQKGIHMTMYFV
*YPVEKNRFQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKIIATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDCSLGNKAFYEKCGLKQKGIHMTMYFV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYPVEKNRFQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKIIATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDCSLGNKAFYEKCGLKQKGIHMTMYFV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query153 2.2.26 [Sep-21-2011]
Q9LFU9149 Glucosamine 6-phosphate N yes no 0.941 0.966 0.673 3e-54
Q5U9F2165 Glucosamine 6-phosphate N yes no 0.941 0.872 0.465 2e-39
C7IZ16166 Probable glucosamine 6-ph no no 0.934 0.861 0.503 3e-39
Q54WR8157 Glucosamine 6-phosphate N yes no 0.915 0.891 0.482 2e-30
O93806149 Glucosamine 6-phosphate N N/A no 0.934 0.959 0.416 1e-24
Q9VAI0219 Probable glucosamine 6-ph yes no 0.856 0.598 0.439 2e-23
Q17427165 Glucosamine 6-phosphate N yes no 0.960 0.890 0.346 1e-20
Q5RAL9184 Glucosamine 6-phosphate N yes no 0.843 0.701 0.407 2e-18
Q96EK6184 Glucosamine 6-phosphate N yes no 0.843 0.701 0.407 2e-18
Q9JK38184 Glucosamine 6-phosphate N yes no 0.830 0.690 0.414 4e-18
>sp|Q9LFU9|GNA1_ARATH Glucosamine 6-phosphate N-acetyltransferase OS=Arabidopsis thaliana GN=GNA1 PE=1 SV=1 Back     alignment and function desciption
 Score =  210 bits (534), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 120/144 (83%)

Query: 9   FQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKI 68
           F++RKLEI+DK KGFIELL QL+V  SV+D++F+ RF E+ SYGDDH++CVIE++ SGKI
Sbjct: 5   FKIRKLEISDKRKGFIELLGQLTVTGSVTDEEFDRRFEEIRSYGDDHVICVIEEETSGKI 64

Query: 69  IATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDC 128
            ATGS+ IEKKFLRNCGK GHIEDVVVD+  RG QLGKK+++FL DH  ++GCYKVILDC
Sbjct: 65  AATGSVMIEKKFLRNCGKAGHIEDVVVDSRFRGKQLGKKVVEFLMDHCKSMGCYKVILDC 124

Query: 129 SLGNKAFYEKCGLKQKGIHMTMYF 152
           S+ NK FYEKCG+  K I M+ YF
Sbjct: 125 SVENKVFYEKCGMSNKSIQMSKYF 148
Acetyltransferase involved in UDP-N-acetylglucosamine (UDP-GlcNAc) biosynthesis. UDP-GlcNAc is an essential metabolite that serves as an initial sugar donor of N-glycan synthesis and thus plays an important role in protein and lipid glycosylation.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 4
>sp|Q5U9F2|GNA1_ORYSJ Glucosamine 6-phosphate N-acetyltransferase 1 OS=Oryza sativa subsp. japonica GN=GNA1 PE=1 SV=1 Back     alignment and function description
>sp|C7IZ16|GNA2_ORYSJ Probable glucosamine 6-phosphate N-acetyltransferase 2 OS=Oryza sativa subsp. japonica GN=Os02g0717700 PE=2 SV=2 Back     alignment and function description
>sp|Q54WR8|GNA1_DICDI Glucosamine 6-phosphate N-acetyltransferase 1 OS=Dictyostelium discoideum GN=gna1 PE=3 SV=1 Back     alignment and function description
>sp|O93806|GNA1_CANAX Glucosamine 6-phosphate N-acetyltransferase OS=Candida albicans GN=GNA1 PE=3 SV=1 Back     alignment and function description
>sp|Q9VAI0|GNA1_DROME Probable glucosamine 6-phosphate N-acetyltransferase OS=Drosophila melanogaster GN=CG1969 PE=2 SV=1 Back     alignment and function description
>sp|Q17427|GNA1_CAEEL Glucosamine 6-phosphate N-acetyltransferase OS=Caenorhabditis elegans GN=gna-1 PE=1 SV=1 Back     alignment and function description
>sp|Q5RAL9|GNA1_PONAB Glucosamine 6-phosphate N-acetyltransferase OS=Pongo abelii GN=GNPNAT1 PE=2 SV=2 Back     alignment and function description
>sp|Q96EK6|GNA1_HUMAN Glucosamine 6-phosphate N-acetyltransferase OS=Homo sapiens GN=GNPNAT1 PE=1 SV=1 Back     alignment and function description
>sp|Q9JK38|GNA1_MOUSE Glucosamine 6-phosphate N-acetyltransferase OS=Mus musculus GN=Gnpnat1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
224142199151 predicted protein [Populus trichocarpa] 0.967 0.980 0.810 2e-65
357511067153 Glucosamine 6-phosphate N-acetyltransfer 1.0 1.0 0.745 2e-62
147794493157 hypothetical protein VITISV_021810 [Viti 0.954 0.929 0.780 4e-62
255575695157 Glucosamine 6-phosphate N-acetyltransfer 0.960 0.936 0.761 5e-62
225440886157 PREDICTED: glucosamine 6-phosphate N-ace 0.954 0.929 0.773 2e-61
449462966157 PREDICTED: glucosamine 6-phosphate N-ace 0.967 0.942 0.743 3e-61
351726556154 uncharacterized protein LOC100527897 [Gl 0.967 0.961 0.75 8e-60
351723881161 uncharacterized protein LOC100499668 [Gl 1.0 0.950 0.699 2e-58
297811713149 hypothetical protein ARALYDRAFT_909552 [ 0.947 0.973 0.668 8e-53
15242389149 glucose-6-phosphate acetyltransferase 1 0.941 0.966 0.673 2e-52
>gi|224142199|ref|XP_002324446.1| predicted protein [Populus trichocarpa] gi|222865880|gb|EEF03011.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 138/148 (93%)

Query: 6   KNRFQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRS 65
           +++F VRKLEI DKSKGFIELLQQL++CDSVSDK+FEERF E++SYGDDH++CVIED RS
Sbjct: 4   EHKFGVRKLEILDKSKGFIELLQQLTICDSVSDKEFEERFQEISSYGDDHLICVIEDVRS 63

Query: 66  GKIIATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVI 125
           GKIIATGS+FIEKKFLRNCGKVGHIEDVVVD++ARGMQLGKKII+FLTDHAH++GCYKVI
Sbjct: 64  GKIIATGSVFIEKKFLRNCGKVGHIEDVVVDSAARGMQLGKKIIEFLTDHAHSMGCYKVI 123

Query: 126 LDCSLGNKAFYEKCGLKQKGIHMTMYFV 153
           LDCSL NKAFYEKCG KQK + M  YF+
Sbjct: 124 LDCSLENKAFYEKCGYKQKEVQMVKYFI 151

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357511067|ref|XP_003625822.1| Glucosamine 6-phosphate N-acetyltransferase [Medicago truncatula] gi|355500837|gb|AES82040.1| Glucosamine 6-phosphate N-acetyltransferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|147794493|emb|CAN62760.1| hypothetical protein VITISV_021810 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255575695|ref|XP_002528747.1| Glucosamine 6-phosphate N-acetyltransferase, putative [Ricinus communis] gi|223531841|gb|EEF33659.1| Glucosamine 6-phosphate N-acetyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225440886|ref|XP_002282617.1| PREDICTED: glucosamine 6-phosphate N-acetyltransferase 1 [Vitis vinifera] gi|297740114|emb|CBI30296.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449462966|ref|XP_004149206.1| PREDICTED: glucosamine 6-phosphate N-acetyltransferase 1-like [Cucumis sativus] gi|449500913|ref|XP_004161229.1| PREDICTED: glucosamine 6-phosphate N-acetyltransferase 1-like [Cucumis sativus] gi|168988200|gb|ACA35270.1| GCN5-related N-acetyltransferase [Cucumis sativus] Back     alignment and taxonomy information
>gi|351726556|ref|NP_001235339.1| uncharacterized protein LOC100527897 [Glycine max] gi|255633496|gb|ACU17106.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|351723881|ref|NP_001238062.1| uncharacterized protein LOC100499668 [Glycine max] gi|255625671|gb|ACU13180.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297811713|ref|XP_002873740.1| hypothetical protein ARALYDRAFT_909552 [Arabidopsis lyrata subsp. lyrata] gi|297319577|gb|EFH49999.1| hypothetical protein ARALYDRAFT_909552 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15242389|ref|NP_197081.1| glucose-6-phosphate acetyltransferase 1 [Arabidopsis thaliana] gi|75174187|sp|Q9LFU9.1|GNA1_ARATH RecName: Full=Glucosamine 6-phosphate N-acetyltransferase; AltName: Full=Glucose-6-phosphate acetyltransferase 1; Short=AtGNA1; AltName: Full=Phosphoglucosamine acetylase; AltName: Full=Phosphoglucosamine transacetylase; AltName: Full=Protein LIGNESCENS gi|383875481|pdb|3T90|A Chain A, Crystal Structure Of Glucosamine-6-Phosphate N-Acetyltransferase From Arabidopsis Thaliana gi|9755622|emb|CAC01776.1| acetyltransferase-like protein [Arabidopsis thaliana] gi|332004820|gb|AED92203.1| glucose-6-phosphate acetyltransferase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
TAIR|locus:2143226149 GNA1 "glucose-6-phosphate acet 0.941 0.966 0.673 2.1e-52
UNIPROTKB|Q5U9F2165 GNA1 "Glucosamine 6-phosphate 0.941 0.872 0.465 1.9e-35
DICTYBASE|DDB_G0279475157 gna1 "glucosamine 6-phosphate 0.908 0.885 0.485 5.4e-31
ASPGD|ASPL0000074909173 gnaA [Emericella nidulans (tax 0.934 0.826 0.375 5.7e-27
CGD|CAL0002717149 GNA1 [Candida albicans (taxid: 0.934 0.959 0.416 2.9e-25
UNIPROTKB|Q5AHF9149 GNA1 "Potential glucosamine ph 0.934 0.959 0.416 2.9e-25
UNIPROTKB|G4NLV8184 MGG_02834 "Glucosamine 6-phosp 0.934 0.777 0.361 4.2e-24
FB|FBgn0039690219 CG1969 [Drosophila melanogaste 0.849 0.593 0.442 4.8e-23
UNIPROTKB|Q2KFU6181 MGCH7_ch7g589 "Putative unchar 0.915 0.773 0.368 6.1e-23
UNIPROTKB|E1C0V1190 GNPNAT1 "Uncharacterized prote 0.843 0.678 0.423 1.1e-21
TAIR|locus:2143226 GNA1 "glucose-6-phosphate acetyltransferase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 543 (196.2 bits), Expect = 2.1e-52, P = 2.1e-52
 Identities = 97/144 (67%), Positives = 120/144 (83%)

Query:     9 FQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKI 68
             F++RKLEI+DK KGFIELL QL+V  SV+D++F+ RF E+ SYGDDH++CVIE++ SGKI
Sbjct:     5 FKIRKLEISDKRKGFIELLGQLTVTGSVTDEEFDRRFEEIRSYGDDHVICVIEEETSGKI 64

Query:    69 IATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDC 128
              ATGS+ IEKKFLRNCGK GHIEDVVVD+  RG QLGKK+++FL DH  ++GCYKVILDC
Sbjct:    65 AATGSVMIEKKFLRNCGKAGHIEDVVVDSRFRGKQLGKKVVEFLMDHCKSMGCYKVILDC 124

Query:   129 SLGNKAFYEKCGLKQKGIHMTMYF 152
             S+ NK FYEKCG+  K I M+ YF
Sbjct:   125 SVENKVFYEKCGMSNKSIQMSKYF 148
GO:0005794 "Golgi apparatus" evidence=ISM
GO:0008080 "N-acetyltransferase activity" evidence=IEA;ISS
GO:0008152 "metabolic process" evidence=ISS
GO:0004343 "glucosamine 6-phosphate N-acetyltransferase activity" evidence=ISS;IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0006044 "N-acetylglucosamine metabolic process" evidence=IDA
UNIPROTKB|Q5U9F2 GNA1 "Glucosamine 6-phosphate N-acetyltransferase 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279475 gna1 "glucosamine 6-phosphate N-acetyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ASPGD|ASPL0000074909 gnaA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0002717 GNA1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5AHF9 GNA1 "Potential glucosamine phosphate N-acetyl tranferase (GNAT family)" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|G4NLV8 MGG_02834 "Glucosamine 6-phosphate acetyltransferase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
FB|FBgn0039690 CG1969 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KFU6 MGCH7_ch7g589 "Putative uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0V1 GNPNAT1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q17427GNA1_CAEEL2, ., 3, ., 1, ., 40.34690.96070.8909yesno
Q54WR8GNA1_DICDI2, ., 3, ., 1, ., 40.48220.91500.8917yesno
Q9LFU9GNA1_ARATH2, ., 3, ., 1, ., 40.67360.94110.9664yesno
P43577GNA1_YEAST2, ., 3, ., 1, ., 40.340.90840.8742yesno
Q5U9F2GNA1_ORYSJ2, ., 3, ., 1, ., 40.46520.94110.8727yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.921
3rd Layer2.3.1.40.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
PLN02706150 PLN02706, PLN02706, glucosamine 6-phosphate N-acet 3e-88
PTZ00330147 PTZ00330, PTZ00330, acetyltransferase; Provisional 8e-23
pfam0058380 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT 2e-13
pfam1350879 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT 2e-08
cd0430165 cd04301, NAT_SF, N-Acyltransferase superfamily: Va 6e-08
COG1670187 COG1670, RimL, Acetyltransferases, including N-ace 3e-05
pfam13527127 pfam13527, Acetyltransf_9, Acetyltransferase (GNAT 6e-05
COG3053 352 COG3053, CitC, Citrate lyase synthetase [Energy pr 2e-04
COG0456177 COG0456, RimI, Acetyltransferases [General functio 2e-04
>gnl|CDD|178308 PLN02706, PLN02706, glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information 
 Score =  253 bits (648), Expect = 3e-88
 Identities = 100/145 (68%), Positives = 123/145 (84%)

Query: 8   RFQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGK 67
           +F+VR+LEI+DKSKGF+ELLQQL+V   V++++FE RF EL S GDDH++CVIED  SG+
Sbjct: 6   KFKVRRLEISDKSKGFLELLQQLTVVGDVTEEEFEARFQELASLGDDHLICVIEDAASGR 65

Query: 68  IIATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILD 127
           IIATGS+F+E+KF+RNCGKVGHIEDVVVD++ARG  LGKKII+ LT+HA + GCYKVILD
Sbjct: 66  IIATGSVFVERKFIRNCGKVGHIEDVVVDSAARGKGLGKKIIEALTEHARSAGCYKVILD 125

Query: 128 CSLGNKAFYEKCGLKQKGIHMTMYF 152
           CS  NKAFYEKCG  +K I M  YF
Sbjct: 126 CSEENKAFYEKCGYVRKEIQMVKYF 150

Length = 150
>gnl|CDD|140351 PTZ00330, PTZ00330, acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family Back     alignment and domain information
>gnl|CDD|222185 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain Back     alignment and domain information
>gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>gnl|CDD|224584 COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|222199 pfam13527, Acetyltransf_9, Acetyltransferase (GNAT) domain Back     alignment and domain information
>gnl|CDD|225595 COG3053, CitC, Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223532 COG0456, RimI, Acetyltransferases [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 153
KOG3396150 consensus Glucosamine-phosphate N-acetyltransferas 99.97
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 99.95
PTZ00330147 acetyltransferase; Provisional 99.94
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 99.92
PHA00673154 acetyltransferase domain containing protein 99.89
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 99.88
KOG3216163 consensus Diamine acetyltransferase [Amino acid tr 99.88
PRK03624140 putative acetyltransferase; Provisional 99.87
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 99.87
PRK07922169 N-acetylglutamate synthase; Validated 99.86
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 99.85
PRK10140162 putative acetyltransferase YhhY; Provisional 99.85
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 99.85
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 99.83
PF13523152 Acetyltransf_8: Acetyltransferase (GNAT) domain; P 99.83
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 99.83
PRK07757152 acetyltransferase; Provisional 99.83
COG1247169 Sortase and related acyltransferases [Cell envelop 99.83
KOG3139165 consensus N-acetyltransferase [General function pr 99.82
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 99.82
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 99.82
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 99.81
COG1246153 ArgA N-acetylglutamate synthase and related acetyl 99.8
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 99.8
COG0456177 RimI Acetyltransferases [General function predicti 99.8
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; 99.79
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 99.78
PRK15130186 spermidine N1-acetyltransferase; Provisional 99.78
PRK01346 411 hypothetical protein; Provisional 99.78
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; 99.78
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 99.77
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 99.77
PRK09831147 putative acyltransferase; Provisional 99.77
PLN02825515 amino-acid N-acetyltransferase 99.77
PF13302142 Acetyltransf_3: Acetyltransferase (GNAT) domain; P 99.77
PRK10514145 putative acetyltransferase; Provisional 99.76
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transf 99.76
COG3153171 Predicted acetyltransferase [General function pred 99.75
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 99.75
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 99.74
PRK05279441 N-acetylglutamate synthase; Validated 99.74
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 99.73
PRK10314153 putative acyltransferase; Provisional 99.73
cd02169 297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 99.72
PHA01807153 hypothetical protein 99.71
PRK10562145 putative acetyltransferase; Provisional 99.7
TIGR03448 292 mycothiol_MshD mycothiol biosynthesis acetyltransf 99.66
TIGR00124 332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 99.63
KOG3235193 consensus Subunit of the major N alpha-acetyltrans 99.62
COG3393268 Predicted acetyltransferase [General function pred 99.61
PRK13688156 hypothetical protein; Provisional 99.59
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 99.49
COG1670187 RimL Acetyltransferases, including N-acetylases of 99.48
KOG2488202 consensus Acetyltransferase (GNAT) domain-containi 99.48
COG3981174 Predicted acetyltransferase [General function pred 99.46
KOG3138187 consensus Predicted N-acetyltransferase [General f 99.46
TIGR01211522 ELP3 histone acetyltransferase, ELP3 family. The S 99.46
KOG3234173 consensus Acetyltransferase, (GNAT) family [Genera 99.44
KOG3397225 consensus Acetyltransferases [General function pre 99.42
COG2153155 ElaA Predicted acyltransferase [General function p 99.36
PF12746265 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S 99.3
KOG4144190 consensus Arylalkylamine N-acetyltransferase [Gene 99.27
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 99.21
PF13718196 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z 99.17
KOG4135185 consensus Predicted phosphoglucosamine acetyltrans 99.09
PF1454278 Acetyltransf_CG: GCN5-related N-acetyl-transferase 99.08
PF12568128 DUF3749: Acetyltransferase (GNAT) domain; InterPro 98.95
PF0844489 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt 98.94
COG4552 389 Eis Predicted acetyltransferase involved in intrac 98.92
COG3053 352 CitC Citrate lyase synthetase [Energy production a 98.86
PF04958 342 AstA: Arginine N-succinyltransferase beta subunit; 98.82
COG3818167 Predicted acetyltransferase, GNAT superfamily [Gen 98.81
COG238899 Predicted acetyltransferase [General function pred 98.73
PRK10456 344 arginine succinyltransferase; Provisional 98.71
TIGR03243 335 arg_catab_AOST arginine and ornithine succinyltran 98.68
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 98.63
TIGR03245 336 arg_AOST_alph arginine/ornithine succinyltransfera 98.62
PF06852181 DUF1248: Protein of unknown function (DUF1248); In 98.57
TIGR03244 336 arg_catab_AstA arginine N-succinyltransferase. In 98.52
PF02799190 NMT_C: Myristoyl-CoA:protein N-myristoyltransferas 98.49
PF13480142 Acetyltransf_6: Acetyltransferase (GNAT) domain 98.42
COG0454156 WecD Histone acetyltransferase HPA2 and related ac 98.3
COG3882574 FkbH Predicted enzyme involved in methoxymalonyl-A 98.26
TIGR03694241 exosort_acyl putative PEP-CTERM/exosortase system- 98.25
PF00765182 Autoind_synth: Autoinducer synthetase; InterPro: I 98.21
PRK13834207 putative autoinducer synthesis protein; Provisiona 98.16
PF01233162 NMT: Myristoyl-CoA:protein N-myristoyltransferase, 98.13
COG1243515 ELP3 Histone acetyltransferase [Transcription / Ch 97.98
COG3375 266 Uncharacterized conserved protein [Function unknow 97.97
PF1388070 Acetyltransf_13: ESCO1/2 acetyl-transferase 97.94
KOG2779421 consensus N-myristoyl transferase [Lipid transport 97.92
COG5628143 Predicted acetyltransferase [General function pred 97.92
COG3138 336 AstA Arginine/ornithine N-succinyltransferase beta 97.8
COG3916209 LasI N-acyl-L-homoserine lactone synthetase [Signa 97.74
TIGR03019330 pepcterm_femAB FemAB-related protein, PEP-CTERM sy 97.72
PF05301120 Mec-17: Touch receptor neuron protein Mec-17; Inte 97.68
PRK14852 989 hypothetical protein; Provisional 97.58
PF01853188 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i 97.28
KOG2535554 consensus RNA polymerase II elongator complex, sub 97.27
KOG2036 1011 consensus Predicted P-loop ATPase fused to an acet 97.15
PRK01305240 arginyl-tRNA-protein transferase; Provisional 97.05
cd0426499 DUF619-NAGS DUF619 domain of various N-acetylgluta 96.99
PF04377128 ATE_C: Arginine-tRNA-protein transferase, C termin 96.94
KOG2779 421 consensus N-myristoyl transferase [Lipid transport 96.85
PLN03238290 probable histone acetyltransferase MYST; Provision 96.85
cd0426599 DUF619-NAGS-U DUF619 domain of various N-acetylglu 96.67
PF04768170 DUF619: Protein of unknown function (DUF619); Inte 96.33
COG2401 593 ABC-type ATPase fused to a predicted acetyltransfe 96.27
PLN03239351 histone acetyltransferase; Provisional 96.26
KOG4601264 consensus Uncharacterized conserved protein [Funct 96.26
PTZ00064 552 histone acetyltransferase; Provisional 96.21
TIGR03827 266 GNAT_ablB putative beta-lysine N-acetyltransferase 96.09
COG5092451 NMT1 N-myristoyl transferase [Lipid metabolism] 95.98
PHA00432137 internal virion protein A 95.94
PLN00104450 MYST -like histone acetyltransferase; Provisional 95.82
PF13444101 Acetyltransf_5: Acetyltransferase (GNAT) domain 95.72
KOG2696 403 consensus Histone acetyltransferase type b catalyt 95.62
KOG3698891 consensus Hyaluronoglucosaminidase [Posttranslatio 95.56
KOG2747396 consensus Histone acetyltransferase (MYST family) 95.14
PF09924299 DUF2156: Uncharacterized conserved protein (DUF215 95.13
PHA01733153 hypothetical protein 94.43
PF11124304 Pho86: Inorganic phosphate transporter Pho86; Inte 93.73
PF09390161 DUF1999: Protein of unknown function (DUF1999); In 93.47
cd04266108 DUF619-NAGS-FABP DUF619 domain of N-acetylglutamat 93.27
PF02474196 NodA: Nodulation protein A (NodA); InterPro: IPR00 91.98
COG2935253 Putative arginyl-tRNA:protein arginylyltransferase 91.33
COG2898538 Uncharacterized conserved protein [Function unknow 90.25
COG5092 451 NMT1 N-myristoyl transferase [Lipid metabolism] 90.08
PF04339370 DUF482: Protein of unknown function, DUF482; Inter 89.55
PRK02983 1094 lysS lysyl-tRNA synthetase; Provisional 89.36
COG5027395 SAS2 Histone acetyltransferase (MYST family) [Chro 88.5
COG5630495 ARG2 Acetylglutamate synthase [Amino acid transpor 87.74
PRK04531398 acetylglutamate kinase; Provisional 87.06
PF12261179 T_hemolysin: Thermostable hemolysin; InterPro: IPR 85.43
PHA02769154 hypothetical protein; Provisional 81.83
COG5653406 Protein involved in cellulose biosynthesis (CelD) 81.72
>KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information 
Probab=99.97  E-value=8.9e-30  Score=148.25  Aligned_cols=149  Identities=50%  Similarity=0.830  Sum_probs=139.0

Q ss_pred             cccCceEEEeCcCCCcchHHHHHHhhhcCCCCCChHHHHHHHHhhccCCCceEEEEEEeCCCCceEEEEEEEeeeeeecC
Q 031789            4 VEKNRFQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKIIATGSIFIEKKFLRN   83 (153)
Q Consensus         4 ~~~~~~~ir~~~~~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vG~~~~~~~~~~~~~   83 (153)
                      ++|..+.+|++..+|..+..++++.++......+++++..++..+......+.+.|++|...+++||++.+.+...+.+.
T Consensus         2 ~~P~~~~lR~L~~~D~~kGf~elL~qLT~vG~vt~e~F~krf~~mk~~~~~Y~i~Vied~~s~~vigtatL~IE~KfIh~   81 (150)
T KOG3396|consen    2 SLPDGFKLRPLEEDDYGKGFIELLKQLTSVGVVTREQFEKRFEAMKKSGDWYYIVVIEDKESEKVIGTATLFIERKFIHG   81 (150)
T ss_pred             CCCCceEEeecccccccchHHHHHHHHhhccccCHHHHHHHHHHHHhcCCcEEEEEEEeCCcCeEEEEEEEEEehhhhhc
Confidence            45677999999999999669999999999889999999999999988886788999998767999999999999999999


Q ss_pred             CCceeEEeeEEeCcCcccCchHHHHHHHHHHHHHHcCCcEEEEEecCCChhhhhhcCceeeCceeeeec
Q 031789           84 CGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDCSLGNKAFYEKCGLKQKGIHMTMYF  152 (153)
Q Consensus        84 ~~~~~~i~~~~v~p~~rg~Gig~~ll~~~~~~~~~~g~~~~~~~~~~~n~~~y~k~Gf~~~~~~~~~~~  152 (153)
                      ++..++|..+.|++++||+++|+.|+..+...+++.|+.++.+.|.+.|+.||+|+||...+..|..|+
T Consensus        82 ~g~rGhiEDVVV~~~~rgk~LGkllv~~Lv~l~k~lgcYKi~LdC~~~nv~FYeKcG~s~~~~~M~~r~  150 (150)
T KOG3396|consen   82 CGSRGHIEDVVVDSEYRGKQLGKLLVETLVDLAKSLGCYKIILDCDPKNVKFYEKCGYSNAGNEMTKRF  150 (150)
T ss_pred             ccccCceeEEEeChhhhhhHHhHHHHHHHHHHHHhcCcEEEEEecchhhhhHHHHcCccccchhheecC
Confidence            999999999999999999999999999999999999999999999999999999999999998887764

>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3139 consensus N-acetyltransferase [General function prediction only] Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>PRK15130 spermidine N1-acetyltransferase; Provisional Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>COG3153 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] Back     alignment and domain information
>COG3393 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] Back     alignment and domain information
>COG3981 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] Back     alignment and domain information
>KOG3397 consensus Acetyltransferases [General function prediction only] Back     alignment and domain information
>COG2153 ElaA Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B Back     alignment and domain information
>KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only] Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B Back     alignment and domain information
>KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A Back     alignment and domain information
>PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length Back     alignment and domain information
>PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 Back     alignment and domain information
>COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>PF04958 AstA: Arginine N-succinyltransferase beta subunit; InterPro: IPR007041 Arginine N-succinyltransferase catalyses the transfer of succinyl-CoA to arginine to produce succinylarginine Back     alignment and domain information
>COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] Back     alignment and domain information
>COG2388 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK10456 arginine succinyltransferase; Provisional Back     alignment and domain information
>TIGR03243 arg_catab_AOST arginine and ornithine succinyltransferase subunits Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03245 arg_AOST_alph arginine/ornithine succinyltransferase, alpha subunit Back     alignment and domain information
>PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans Back     alignment and domain information
>TIGR03244 arg_catab_AstA arginine N-succinyltransferase Back     alignment and domain information
>PF02799 NMT_C: Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain; InterPro: IPR022677 Myristoyl-CoA:protein N-myristoyltransferase (2 Back     alignment and domain information
>PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase Back     alignment and domain information
>PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth Back     alignment and domain information
>PRK13834 putative autoinducer synthesis protein; Provisional Back     alignment and domain information
>PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 Back     alignment and domain information
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>COG3375 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase Back     alignment and domain information
>KOG2779 consensus N-myristoyl transferase [Lipid transport and metabolism] Back     alignment and domain information
>COG5628 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG3138 AstA Arginine/ornithine N-succinyltransferase beta subunit [Amino acid transport and metabolism] Back     alignment and domain information
>COG3916 LasI N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated Back     alignment and domain information
>PF05301 Mec-17: Touch receptor neuron protein Mec-17; InterPro: IPR007965 Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus Back     alignment and domain information
>KOG2535 consensus RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK01305 arginyl-tRNA-protein transferase; Provisional Back     alignment and domain information
>cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish Back     alignment and domain information
>PF04377 ATE_C: Arginine-tRNA-protein transferase, C terminus; InterPro: IPR007472 Arginine-tRNA-protein transferase catalyses the post-translational conjugation of arginine to the N terminus of a protein Back     alignment and domain information
>KOG2779 consensus N-myristoyl transferase [Lipid transport and metabolism] Back     alignment and domain information
>PLN03238 probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish Back     alignment and domain information
>PF04768 DUF619: Protein of unknown function (DUF619); InterPro: IPR006855 This region of unknown function is found at the C terminus of Neurospora crassa acetylglutamate synthase (2 Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>PLN03239 histone acetyltransferase; Provisional Back     alignment and domain information
>KOG4601 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00064 histone acetyltransferase; Provisional Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>COG5092 NMT1 N-myristoyl transferase [Lipid metabolism] Back     alignment and domain information
>PHA00432 internal virion protein A Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>PF13444 Acetyltransf_5: Acetyltransferase (GNAT) domain Back     alignment and domain information
>KOG2696 consensus Histone acetyltransferase type b catalytic subunit [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3698 consensus Hyaluronoglucosaminidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2747 consensus Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>PF09924 DUF2156: Uncharacterized conserved protein (DUF2156); InterPro: IPR024320 This domain of unknown function is found in uncharacterised proteins and in Lysylphosphatidylglycerol synthetase, which catalyses the transfer of a lysyl group from L-lysyl-tRNA(Lys) to membrane-bound phosphatidylglycerol [] Back     alignment and domain information
>PHA01733 hypothetical protein Back     alignment and domain information
>PF11124 Pho86: Inorganic phosphate transporter Pho86; InterPro: IPR024297 Pho86p is an ER protein which is produced in response to phosphate starvation Back     alignment and domain information
>PF09390 DUF1999: Protein of unknown function (DUF1999); InterPro: IPR018987 This family contains a putative Fe-S binding reductase (Q72J89 from SWISSPROT) whose structure adopts an alpha and beta fold Back     alignment and domain information
>cd04266 DUF619-NAGS-FABP DUF619 domain of N-acetylglutamate Synthase of the fungal arginine-biosynthetic pathway Back     alignment and domain information
>PF02474 NodA: Nodulation protein A (NodA); InterPro: IPR003484 Rhizobial nodulation (Nod) factors are signalling molecules secreted by root-nodulating rhizobia in response to flavanoids excreted by the host plant Back     alignment and domain information
>COG2935 Putative arginyl-tRNA:protein arginylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2898 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5092 NMT1 N-myristoyl transferase [Lipid metabolism] Back     alignment and domain information
>PF04339 DUF482: Protein of unknown function, DUF482; InterPro: IPR007434 This family contains several proteins of uncharacterised function Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>COG5630 ARG2 Acetylglutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04531 acetylglutamate kinase; Provisional Back     alignment and domain information
>PF12261 T_hemolysin: Thermostable hemolysin; InterPro: IPR022050 This family of proteins is found in bacteria Back     alignment and domain information
>PHA02769 hypothetical protein; Provisional Back     alignment and domain information
>COG5653 Protein involved in cellulose biosynthesis (CelD) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
3t90_A149 Crystal Structure Of Glucosamine-6-Phosphate N-Acet 3e-55
2vxk_A190 Structural Comparison Between Aspergillus Fumigatus 2e-27
4ag7_A165 C. Elegans Glucosamine-6-Phosphate N-Acetyltransfer 1e-21
2huz_A184 Crystal Structure Of Gnpnat1 Length = 184 2e-19
3cxp_A184 Crystal Structure Of Human Glucosamine 6-Phosphate 5e-19
1i12_A160 Crystal Structure Of Saccharomyces Cerevisiae Gna1 2e-17
1i1d_A161 Crystal Structure Of Yeast Gna1 Bound To Coa And Gl 2e-17
1i21_A159 Crystal Structure Of Yeast Gna1 Length = 159 3e-16
3fb3_A161 Crystal Structure Of Trypanosoma Brucei Acetyltrans 7e-16
2dxq_A150 Putative Acetyltransferase From Agrobacterium Tumef 7e-07
>pdb|3T90|A Chain A, Crystal Structure Of Glucosamine-6-Phosphate N-Acetyltransferase From Arabidopsis Thaliana Length = 149 Back     alignment and structure 
Iteration: 1

 Score =  210 bits (534), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 120/144 (83%)
Query: 9   FQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKI 68
           F++RKLEI+DK KGFIELL QL+V  SV+D++F+ RF E+ SYGDDH++CVIE++ SGKI
Sbjct: 5   FKIRKLEISDKRKGFIELLGQLTVTGSVTDEEFDRRFEEIRSYGDDHVICVIEEETSGKI 64
Query: 69  IATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDC 128
            ATGS+ IEKKFLRNCGK GHIEDVVVD+  RG QLGKK+++FL DH  ++GCYKVILDC
Sbjct: 65  AATGSVMIEKKFLRNCGKAGHIEDVVVDSRFRGKQLGKKVVEFLMDHCKSMGCYKVILDC 124
Query: 129 SLGNKAFYEKCGLKQKGIHMTMYF 152
           S+ NK FYEKCG+  K I M+ YF
Sbjct: 125 SVENKVFYEKCGMSNKSIQMSKYF 148
>pdb|2VXK|A Chain A, Structural Comparison Between Aspergillus Fumigatus And Human Gna1 Length = 190 Back     alignment and structure
>pdb|4AG7|A Chain A, C. Elegans Glucosamine-6-Phosphate N-Acetyltransferase (Gna1): Coenzyme A Adduct Length = 165 Back     alignment and structure
>pdb|2HUZ|A Chain A, Crystal Structure Of Gnpnat1 Length = 184 Back     alignment and structure
>pdb|3CXP|A Chain A, Crystal Structure Of Human Glucosamine 6-Phosphate N- Acetyltransferase 1 Mutant E156a Length = 184 Back     alignment and structure
>pdb|1I12|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Gna1 Complexed With Accoa Length = 160 Back     alignment and structure
>pdb|1I1D|A Chain A, Crystal Structure Of Yeast Gna1 Bound To Coa And Glnac-6p Length = 161 Back     alignment and structure
>pdb|1I21|A Chain A, Crystal Structure Of Yeast Gna1 Length = 159 Back     alignment and structure
>pdb|3FB3|A Chain A, Crystal Structure Of Trypanosoma Brucei Acetyltransferase, Tb11.01.2886 Length = 161 Back     alignment and structure
>pdb|2DXQ|A Chain A, Putative Acetyltransferase From Agrobacterium Tumefaciens Str. C58 Length = 150 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 7e-54
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 1e-53
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 3e-51
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 6e-48
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 2e-45
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 3e-43
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 7e-40
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 5e-25
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 4e-22
3mgd_A157 Predicted acetyltransferase; structural genomics, 1e-21
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 3e-18
1vkc_A158 Putative acetyl transferase; structural genomics, 7e-17
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 8e-17
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 6e-15
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 6e-15
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 8e-15
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 8e-15
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 9e-15
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 1e-14
2eui_A153 Probable acetyltransferase; dimer, structural geno 1e-14
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 2e-14
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 1e-13
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 3e-13
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 8e-13
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 1e-12
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 1e-12
2aj6_A159 Hypothetical protein MW0638; structural genomics, 1e-12
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 7e-12
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 2e-11
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 2e-10
3efa_A147 Putative acetyltransferase; structural genom 2, pr 3e-10
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 5e-10
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 5e-10
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structura 6e-10
3c26_A 266 Putative acetyltransferase TA0821; NP_394282.1, A 6e-10
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 1e-09
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 2e-09
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 3e-09
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 4e-09
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 5e-09
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 5e-09
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 6e-09
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 6e-09
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 7e-09
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 7e-09
3frm_A254 Uncharacterized conserved protein; APC61048, staph 7e-09
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 1e-08
1y7r_A133 Hypothetical protein SA2161; structural genomics, 1e-08
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 2e-08
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 2e-08
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 2e-08
3owc_A188 Probable acetyltransferase; structural genomics, P 3e-08
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 3e-08
2i6c_A160 Putative acetyltransferase; GNAT family, structura 3e-08
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 4e-08
3kkw_A182 Putative uncharacterized protein; acetyltransferas 4e-08
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 9e-08
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 1e-07
1wwz_A159 Hypothetical protein PH1933; structural genomics, 2e-07
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 2e-07
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 2e-07
2gan_A190 182AA long hypothetical protein; alpha-beta protei 2e-07
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 3e-07
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 3e-07
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 3e-07
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 4e-07
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 4e-07
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 6e-07
2fl4_A149 Spermine/spermidine acetyltransferase; structural 6e-07
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 7e-07
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 7e-07
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 9e-07
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 1e-06
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 1e-06
1tiq_A180 Protease synthase and sporulation negative regulat 2e-06
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 3e-06
3sxn_A 422 Enhanced intracellular surviVal protein; GNAT fold 3e-06
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 3e-06
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 6e-06
2fe7_A166 Probable N-acetyltransferase; structural genomics, 6e-06
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 9e-06
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 2e-05
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 3e-05
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 3e-05
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 5e-05
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 5e-05
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 8e-05
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 8e-05
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 9e-05
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 9e-05
3r1k_A 428 Enhanced intracellular surviVal protein; GNAT, ace 1e-04
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 2e-04
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 2e-04
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 2e-04
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 2e-04
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 2e-04
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 2e-04
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 3e-04
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 5e-04
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 5e-04
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 8e-04
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Length = 149 Back     alignment and structure
 Score =  166 bits (421), Expect = 7e-54
 Identities = 97/144 (67%), Positives = 120/144 (83%)

Query: 9   FQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKI 68
           F++RKLEI+DK KGFIELL QL+V  SV+D++F+ RF E+ SYGDDH++CVIE++ SGKI
Sbjct: 5   FKIRKLEISDKRKGFIELLGQLTVTGSVTDEEFDRRFEEIRSYGDDHVICVIEEETSGKI 64

Query: 69  IATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDC 128
            ATGS+ IEKKFLRNCGK GHIEDVVVD+  RG QLGKK+++FL DH  ++GCYKVILDC
Sbjct: 65  AATGSVMIEKKFLRNCGKAGHIEDVVVDSRFRGKQLGKKVVEFLMDHCKSMGCYKVILDC 124

Query: 129 SLGNKAFYEKCGLKQKGIHMTMYF 152
           S+ NK FYEKCG+  K I M+ YF
Sbjct: 125 SVENKVFYEKCGMSNKSIQMSKYF 148
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Length = 165 Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Length = 190 Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Length = 184 Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Length = 161 Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Length = 160 Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Length = 150 Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Length = 150 Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Length = 153 Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157 Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Length = 168 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Length = 158 Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Length = 166 Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Length = 181 Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Length = 166 Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153 Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 180 Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Length = 164 Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Length = 158 Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Length = 153 Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Length = 165 Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Length = 176 Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Length = 145 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Length = 157 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Length = 138 Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Length = 172 Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Length = 159 Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Length = 144 Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Length = 187 Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Length = 172 Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Length = 147 Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Length = 146 Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Length = 140 Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Length = 288 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Length = 266 Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Length = 166 Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Length = 157 Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Length = 140 Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 199 Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Length = 169 Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Length = 276 Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Length = 170 Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Length = 142 Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Length = 152 Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157 Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Length = 254 Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Length = 150 Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Length = 133 Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Length = 207 Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Length = 177 Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Length = 152 Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Length = 188 Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 166 Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Length = 160 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Length = 172 Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Length = 182 Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 163 Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 162 Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 159 Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Length = 177 Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Length = 160 Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 190 Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Length = 170 Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Length = 330 Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Length = 171 Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Length = 204 Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Length = 174 Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Length = 189 Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 149 Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Length = 177 Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Length = 162 Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Length = 179 Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Length = 183 Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Length = 180 Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Length = 180 Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Length = 197 Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Length = 422 Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Length = 160 Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Length = 235 Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Length = 166 Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Length = 228 Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Length = 160 Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Length = 197 Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Length = 170 Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Length = 163 Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Length = 181 Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Length = 147 Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Length = 164 Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Length = 183 Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Length = 168 Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} Length = 428 Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Length = 222 Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Length = 181 Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Length = 209 Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Length = 150 Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Length = 188 Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Length = 318 Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Length = 143 Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} Length = 163 Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} Length = 215 Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Length = 217 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 99.97
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 99.97
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 99.96
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 99.96
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 99.95
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 99.95
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 99.95
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 99.94
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 99.93
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 99.93
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 99.93
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 99.93
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 99.93
3mgd_A157 Predicted acetyltransferase; structural genomics, 99.92
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 99.92
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 99.92
1tiq_A180 Protease synthase and sporulation negative regulat 99.92
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 99.92
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 99.92
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 99.92
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 99.91
3kkw_A182 Putative uncharacterized protein; acetyltransferas 99.91
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 99.91
2eui_A153 Probable acetyltransferase; dimer, structural geno 99.91
2fe7_A166 Probable N-acetyltransferase; structural genomics, 99.91
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 99.91
1wwz_A159 Hypothetical protein PH1933; structural genomics, 99.91
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 99.91
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 99.91
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 99.91
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 99.91
3owc_A188 Probable acetyltransferase; structural genomics, P 99.91
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 99.91
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 99.91
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 99.91
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 99.91
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 99.91
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 99.9
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 99.9
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 99.9
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 99.9
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 99.9
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 99.9
1vkc_A158 Putative acetyl transferase; structural genomics, 99.9
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 99.9
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 99.9
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 99.9
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 99.9
2i6c_A160 Putative acetyltransferase; GNAT family, structura 99.9
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 99.9
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 99.9
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 99.9
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 99.89
2aj6_A159 Hypothetical protein MW0638; structural genomics, 99.89
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 99.89
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 99.89
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 99.89
3efa_A147 Putative acetyltransferase; structural genom 2, pr 99.89
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 99.89
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 99.89
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 99.89
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 99.89
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 99.89
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structura 99.89
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 99.89
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 99.88
1y7r_A133 Hypothetical protein SA2161; structural genomics, 99.88
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 99.88
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 99.88
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 99.88
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 99.88
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 99.88
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 99.88
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 99.88
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 99.88
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 99.88
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 99.88
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 99.88
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 99.88
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 99.88
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 99.88
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 99.88
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 99.88
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 99.88
1nsl_A184 Probable acetyltransferase; structural genomics, h 99.88
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 99.88
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 99.87
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 99.87
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 99.87
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 99.87
3tcv_A246 GCN5-related N-acetyltransferase; GRAM negative co 99.87
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 99.87
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 99.87
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 99.87
3juw_A175 Probable GNAT-family acetyltransferase; structural 99.87
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 99.86
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 99.86
2fl4_A149 Spermine/spermidine acetyltransferase; structural 99.86
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 99.86
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 99.86
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 99.86
1xeb_A150 Hypothetical protein PA0115; midwest center for st 99.86
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 99.85
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 99.85
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 99.85
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 99.85
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 99.85
3r1k_A 428 Enhanced intracellular surviVal protein; GNAT, ace 99.85
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 99.85
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 99.85
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 99.85
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 99.85
3frm_A254 Uncharacterized conserved protein; APC61048, staph 99.85
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 99.85
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 99.85
3c26_A 266 Putative acetyltransferase TA0821; NP_394282.1, A 99.85
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, prote 99.84
2qml_A198 BH2621 protein; structural genomics, joint center 99.84
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic 99.84
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 99.84
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 99.83
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 99.83
2d4p_A141 Hypothetical protein TTHA1254; structural genomics 99.83
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 99.83
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 99.83
3sxn_A 422 Enhanced intracellular surviVal protein; GNAT fold 99.82
2gan_A190 182AA long hypothetical protein; alpha-beta protei 99.82
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 99.82
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 99.82
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 99.82
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 99.82
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransfe 99.82
2i00_A 406 Acetyltransferase, GNAT family; structural genomic 99.81
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 99.81
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 99.81
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 99.81
1z4r_A168 General control of amino acid synthesis protein 5- 99.8
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 99.8
2hv2_A 400 Hypothetical protein; PSI, protein structure initi 99.8
3tt2_A 330 GCN5-related N-acetyltransferase; structural genom 99.79
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 99.78
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 99.78
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 99.78
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 99.78
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, a 99.77
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 99.76
2zw5_A 301 Bleomycin acetyltransferase; dimer, two domains; H 99.75
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 99.75
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 99.73
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 99.65
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 99.65
3shp_A176 Putative acetyltransferase STHE_0691; PSI-biology, 99.59
1p0h_A 318 Hypothetical protein RV0819; GNAT fold, acetyltran 99.56
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 99.56
1yle_A 342 Arginine N-succinyltransferase, alpha chain; struc 99.39
1ro5_A201 Autoinducer synthesis protein LASI; alpha-beta-alp 99.34
3dns_A135 Ribosomal-protein-alanine acetyltransferase; N-ter 99.3
1bob_A320 HAT1, histone acetyltransferase; histone modificat 99.25
3p2h_A201 AHL synthase; acyl-ACP binding, SAM binding, signa 99.23
1xmt_A103 Putative acetyltransferase; structural genomics, p 99.22
1kzf_A230 Acyl-homoserinelactone synthase ESAI; alpha-beta, 99.1
4b14_A385 Glycylpeptide N-tetradecanoyltransferase; malaria, 98.33
3iu1_A383 Glycylpeptide N-tetradecanoyltransferase 1; N-myri 98.31
2wuu_A421 N-myristoyltransferase; acyltransferase; HET: NHM; 98.26
1iyk_A392 Myristoyl-COA:protein N-myristoyltransferase; HET: 98.24
1iic_A422 Peptide N-myristoyltransferase; HET: MYA; 2.20A {S 98.21
4b14_A 385 Glycylpeptide N-tetradecanoyltransferase; malaria, 98.04
1iyk_A 392 Myristoyl-COA:protein N-myristoyltransferase; HET: 98.03
1iic_A 422 Peptide N-myristoyltransferase; HET: MYA; 2.20A {S 97.94
2wuu_A 421 N-myristoyltransferase; acyltransferase; HET: NHM; 97.91
3iu1_A 383 Glycylpeptide N-tetradecanoyltransferase 1; N-myri 97.9
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 97.89
3s6g_A460 N-acetylglutamate kinase / N-acetylglutamate SYNT; 97.84
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 97.69
4hkf_A191 Alpha-tubulin N-acetyltransferase; tubulin acetylt 97.6
1rxt_A 496 Myristoyl-, glycylpeptide N-tetradecanoyltransfera 97.44
1rxt_A496 Myristoyl-, glycylpeptide N-tetradecanoyltransfera 97.37
4b5o_A200 Alpha-tubulin N-acetyltransferase; microtubules, c 97.37
3s6k_A467 Acetylglutamate kinase; synthase, transferase; 2.8 97.35
4h6u_A200 Alpha-tubulin N-acetyltransferase; tubulin acetylt 97.29
4gs4_A240 Alpha-tubulin N-acetyltransferase; acetyl coenzyme 97.28
3gkr_A336 FEMX; FEMX, peptidoglycan, hexapeptide, transferas 97.18
4ab7_A464 Protein Arg5,6, mitochondrial; transferase, argini 97.05
3to7_A276 Histone acetyltransferase ESA1; MYST family; HET: 96.97
2ozu_A284 Histone acetyltransferase MYST3; structural genomi 96.97
2ou2_A280 Histone acetyltransferase htatip; structural genom 96.94
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, str 96.93
3iwg_A 276 Acetyltransferase, GNAT family; structural genomic 96.81
1lrz_A426 FEMA, factor essential for expression of methicill 96.13
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 90.48
2hqy_A305 Conserved hypothetical protein; PSI2, MAD, structu 88.2
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 87.94
1qys_A106 TOP7; alpha-beta, novel fold, de novo protein; 2.5 86.08
2hv2_A 400 Hypothetical protein; PSI, protein structure initi 86.04
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
Probab=99.97  E-value=1.1e-28  Score=153.45  Aligned_cols=144  Identities=36%  Similarity=0.505  Sum_probs=121.1

Q ss_pred             ccCceEEEeCcCCCcchHHHHHHhhhcCCCCCChHHHHHHHHhhccCCCceEEEEEEeCCCCceEEEEEEEeeeeeecCC
Q 031789            5 EKNRFQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSYGDDHIVCVIEDDRSGKIIATGSIFIEKKFLRNC   84 (153)
Q Consensus         5 ~~~~~~ir~~~~~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vG~~~~~~~~~~~~~~   84 (153)
                      |++++.||+++++|++ ++.+++........++.+.+...+...........++++..+  |++||++.+..........
T Consensus        17 m~~~~~ir~~~~~D~~-~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~--~~~vG~~~~~~~~~~~~~~   93 (161)
T 3i3g_A           17 QGVDLELRVLEESDLS-SHLELLGHLTEAPPLSGVELANIADMRRRAGIVTKVFCHQPT--GRIVGSASLMIQPKFTRGG   93 (161)
T ss_dssp             --CCEEEEECCGGGHH-HHHHHHTTTSCCCCCCHHHHHHHHHHHHHTTCEEEEEEETTT--TEEEEEEEEEEECCSSGGG
T ss_pred             CCccEEEEECcHhhHH-HHHHHHHHhccCCCCCHHHHHHHHHHHhhcCCceEEEEEEcC--CCeEEEEEEEeccCCCCCC
Confidence            4567999999999999 699999888777678888888887776665545666666664  9999999998654433334


Q ss_pred             CceeEEeeEEeCcCcccCchHHHHHHHHHHHHHHcCCcEEEEEecCCChhhhhhcCceeeCceeeee
Q 031789           85 GKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDCSLGNKAFYEKCGLKQKGIHMTMY  151 (153)
Q Consensus        85 ~~~~~i~~~~v~p~~rg~Gig~~ll~~~~~~~~~~g~~~~~~~~~~~n~~~y~k~Gf~~~~~~~~~~  151 (153)
                      ...++|..++|+|+|||+|+|++|++.+++++++.|+..+.+.+++.|++||+|+||+..+..+.+.
T Consensus        94 ~~~~~i~~~~V~p~~rg~Gig~~Ll~~~~~~a~~~g~~~i~l~~~~~n~~~y~k~GF~~~~~~~~~~  160 (161)
T 3i3g_A           94 RAVGHIEDVVVDPSYRGAGLGKALIMDLCEISRSKGCYKVILDSSEKSLPFYEKLGFRAHERQMRLD  160 (161)
T ss_dssp             CCEEEEEEEEECGGGTTTTHHHHHHHHHHHHHHHTTCSEEEEEECTTTHHHHHHTTCEEEEEEEEEE
T ss_pred             ccEEEEEEEEEcHHHcccCHHHHHHHHHHHHHHHcCCcEEEEEecccchhHHHhcCCeecCceeecc
Confidence            6789999999999999999999999999999999999999999999999999999999999887654
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 Back     alignment and structure
>1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 Back     alignment and structure
>3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* Back     alignment and structure
>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* Back     alignment and structure
>1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A Back     alignment and structure
>4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* Back     alignment and structure
>3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* Back     alignment and structure
>2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* Back     alignment and structure
>1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A Back     alignment and structure
>1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* Back     alignment and structure
>4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* Back     alignment and structure
>1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A Back     alignment and structure
>1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* Back     alignment and structure
>2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* Back     alignment and structure
>3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A* Back     alignment and structure
>1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 Back     alignment and structure
>1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 Back     alignment and structure
>4b5o_A Alpha-tubulin N-acetyltransferase; microtubules, cilium, intraflagellar transport; HET: ACO; 1.05A {Homo sapiens} PDB: 4b5p_A* Back     alignment and structure
>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Back     alignment and structure
>4h6u_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase; HET: ACO; 2.45A {Danio rerio} PDB: 4h6z_A* Back     alignment and structure
>4gs4_A Alpha-tubulin N-acetyltransferase; acetyl coenzyme A binding, cytosolic; HET: ACO; 2.11A {Homo sapiens} Back     alignment and structure
>3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A Back     alignment and structure
>4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* Back     alignment and structure
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Back     alignment and structure
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Back     alignment and structure
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>1lrz_A FEMA, factor essential for expression of methicillin resistance; peptidoglycan, X-RAY crystallography, multiple anomalous dispersion; 2.10A {Staphylococcus aureus} SCOP: a.2.7.4 d.108.1.4 d.108.1.4 Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2hqy_A Conserved hypothetical protein; PSI2, MAD, structural G protein structure initiative, midwest center for structural genomics; HET: COA; 1.80A {Bacteroides thetaiotaomicron} SCOP: d.108.1.4 d.108.1.4 Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>1qys_A TOP7; alpha-beta, novel fold, de novo protein; 2.50A {Computationally designed sequence} SCOP: k.41.1.1 Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 153
d1i12a_157 d.108.1.1 (A:) Glucosamine-phosphate N-acetyltrans 2e-24
d1z4ea1150 d.108.1.1 (A:4-153) Transcriptional regulator BH19 4e-15
d1vkca_149 d.108.1.1 (A:) Putative acetyltransferase PF0028 { 3e-14
d1m4ia_181 d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransfera 5e-13
d2atra1137 d.108.1.1 (A:1-137) Probable acetyltransferase SP0 2e-11
d2jdca1145 d.108.1.1 (A:2-146) Probable acetyltransferase Yit 5e-11
d1y7ra1133 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {S 2e-10
d1ufha_155 d.108.1.1 (A:) Putative acetyltransferase YycN {Ba 4e-10
d2hv2a2 285 d.108.1.10 (A:2-286) Hypothetical protein EF1021 { 2e-09
d1cjwa_166 d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep 4e-09
d1s3za_147 d.108.1.1 (A:) Aminoglycoside N-acetyltransferase 3e-08
d2cy2a1174 d.108.1.1 (A:1-174) Probable acetyltransferase TTH 8e-08
d2gana1182 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {P 1e-07
d1qsra_162 d.108.1.1 (A:) Catalytic domain of GCN5 histone ac 1e-07
d1u6ma_189 d.108.1.1 (A:) Putative acetyltransferase EF0945 { 2e-07
d1z4ra1162 d.108.1.1 (A:497-658) Catalytic domain of GCN5 his 3e-07
d1p0ha_308 d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacter 4e-07
d1tiqa_173 d.108.1.1 (A:) Protease synthase and sporulation n 5e-07
d1n71a_180 d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransfera 1e-06
d2fe7a1156 d.108.1.1 (A:3-158) Probable N-acetyltransferase P 7e-06
d2aj6a1118 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {S 9e-06
d1y9ka1152 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillu 9e-06
d2fiwa1156 d.108.1.1 (A:2-157) Probable N-acetyltransferase R 1e-05
d2euia1153 d.108.1.1 (A:1-153) Probable acetyltransferase PA4 1e-05
d1ygha_164 d.108.1.1 (A:) Catalytic domain of GCN5 histone ac 2e-05
d1wwza1157 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {P 3e-05
d1q2ya_140 d.108.1.1 (A:) Probable acetyltransferase YjcF {Ba 8e-05
d1qsma_150 d.108.1.1 (A:) Histone acetyltransferase HPA2 {Bak 2e-04
d2b5ga1167 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {H 0.001
d2beia1167 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {H 0.001
d1xmta_95 d.108.1.1 (A:) Hypothetical protein AT1g77540 {Tha 0.002
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 157 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Glucosamine-phosphate N-acetyltransferase GNA1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 90.4 bits (223), Expect = 2e-24
 Identities = 49/154 (31%), Positives = 76/154 (49%), Gaps = 11/154 (7%)

Query: 7   NRFQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERF----------LELNSYGDDHI 56
           + F +R++E  D  +   E L+ L+   +++ + F +               +     + 
Sbjct: 3   DGFYIRRMEEGD-LEQVTETLKVLTTVGTITPESFCKLIKYWNEATVWNDNEDKKIMQYN 61

Query: 57  VCVIEDDRSGKIIATGSIFIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHA 116
             VI D R+  + ATG+I IE+K +   G  GHIED+ V++  +G  LGK +I  L    
Sbjct: 62  PMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLVTIG 121

Query: 117 HAVGCYKVILDCSLGNKAFYEKCGLKQKGIHMTM 150
              GCYK+ILDC   N  FYEKCG    G+ M +
Sbjct: 122 FDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQI 155
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Length = 150 Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Length = 149 Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Length = 137 Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Length = 145 Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Length = 133 Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Length = 155 Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Length = 285 Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Length = 166 Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Length = 147 Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Length = 182 Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Length = 162 Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Length = 189 Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 308 Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Length = 173 Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Length = 180 Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Length = 156 Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Length = 118 Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Length = 152 Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Length = 156 Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Length = 153 Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Length = 157 Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Length = 140 Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 150 Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 99.96
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 99.95
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 99.94
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 99.94
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 99.93
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 99.93
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aer 99.93
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 99.93
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 99.92
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 99.92
d1tiqa_173 Protease synthase and sporulation negative regulat 99.92
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 99.92
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 99.92
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 99.91
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 99.91
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 99.91
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 99.91
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 99.9
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 99.9
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 99.9
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 99.9
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 99.9
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 99.9
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 99.9
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 99.89
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 99.89
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 99.89
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 99.89
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 99.89
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) 99.88
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 99.88
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 99.88
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 99.87
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 99.87
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 99.87
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 99.86
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 99.85
d2fcka1178 Putative ribosomal-protein-serine acetyltransferas 99.85
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 99.85
d1yrea1183 Hypothetical protein PA3270 {Pseudomonas aeruginos 99.84
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis 99.84
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 99.83
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 99.83
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 99.82
d1s7ka1174 L7/L12-Ribosomal-protein-serine acetyltransferase 99.81
d2hv2a2 285 Hypothetical protein EF1021 {Enterococcus faecalis 99.81
d2ozga2 283 Putative acetyltransferase Ava4977 {Anabaena varia 99.8
d1yk3a1198 Hypothetical protein Rv1347c/MT1389 {Mycobacterium 99.8
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 99.79
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 99.79
d2i00a2 291 Putative acetyltransferase EF2353 {Enterococcus fa 99.78
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 99.78
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 99.74
d1m4ia_181 Aminoglycoside 2'-N-acetyltransferase {Mycobacteri 99.72
d2fsra1164 Probable acetyltranferase Atu2435 {Agrobacterium t 99.68
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 99.51
d1p0ha_ 308 Mycothiol synthase MshD {Mycobacterium tuberculosi 99.15
d1ylea1 338 Arginine N-succinyltransferase, alpha chain, AstA 99.01
d1ro5a_197 Autoinducer synthesis protein LasI {Pseudomonas ae 98.98
d1xmta_95 Hypothetical protein AT1g77540 {Thale cress (Arabi 98.6
d1kzfa_210 Acyl-homoserinelactone synthase EsaI {Pantoea stew 98.57
d1iyka1165 N-myristoyl transferase, NMT {Yeast (Candida albic 98.49
d1iyka2227 N-myristoyl transferase, NMT {Yeast (Candida albic 98.44
d1iica2237 N-myristoyl transferase, NMT {Baker's yeast (Sacch 98.38
d1iica1185 N-myristoyl transferase, NMT {Baker's yeast (Sacch 98.34
d1lrza3182 Methicillin resistance protein FemA {Staphylococcu 98.25
d1boba_315 Histone acetyltransferase HAT1 {Baker's yeast (Sac 98.21
d1rxta1141 N-myristoyl transferase, NMT {Human (Homo sapiens) 98.07
d1rxta2201 N-myristoyl transferase, NMT {Human (Homo sapiens) 97.66
d1ne9a2171 Peptidyltransferase FemX {Weissella viridescens [T 97.57
d2giva1271 Probable histone acetyltransferase MYST1 {Human (H 97.19
d2ozua1270 Histone acetyltransferase MYST3 {Human (Homo sapie 97.14
d1fy7a_273 Histone acetyltransferase ESA1 {Baker's yeast (Sac 97.07
d1lrza2165 Methicillin resistance protein FemA {Staphylococcu 96.44
d2ozga2283 Putative acetyltransferase Ava4977 {Anabaena varia 94.98
d2hqya1164 Hypothetical protein BT3689 {Bacteroides thetaiota 93.52
d2i00a2291 Putative acetyltransferase EF2353 {Enterococcus fa 93.04
d2d4pa1130 Hypothetical protein TTHA1254 {Thermus thermophilu 90.97
d2hv2a2285 Hypothetical protein EF1021 {Enterococcus faecalis 90.47
d1ne9a1164 Peptidyltransferase FemX {Weissella viridescens [T 82.45
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Glucosamine-phosphate N-acetyltransferase GNA1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.96  E-value=6.9e-29  Score=152.77  Aligned_cols=146  Identities=34%  Similarity=0.566  Sum_probs=113.3

Q ss_pred             ccCceEEEeCcCCCcchHHHHHHhhhcCCCCCChHHHHHHHHhhccC----------CCceEEEEEEeCCCCceEEEEEE
Q 031789            5 EKNRFQVRKLEITDKSKGFIELLQQLSVCDSVSDKQFEERFLELNSY----------GDDHIVCVIEDDRSGKIIATGSI   74 (153)
Q Consensus         5 ~~~~~~ir~~~~~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----------~~~~~~~~~~~~~~~~~vG~~~~   74 (153)
                      +|..++||+++++|++ +++++++........+.+.+...+..+...          ......+++..+.++++||++.+
T Consensus         1 ~p~~~~IR~~~~~D~~-~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ivG~~~~   79 (157)
T d1i12a_           1 LPDGFYIRRMEEGDLE-QVTETLKVLTTVGTITPESFCKLIKYWNEATVWNDNEDKKIMQYNPMVIVDKRTETVAATGNI   79 (157)
T ss_dssp             CCTTEEEEECCGGGHH-HHHHHHTTTSCCCCCCHHHHHHHHHHHHHCBCCCC---CCCBSBCCEEEEETTTTEEEEEEEE
T ss_pred             CCCCcEEEeCCHHHHH-HHHHHHHHHhhccccCHHHHHHHHHhhhhhhhHHHhhhhcccccceEEEEEEECCEEEEEEEE
Confidence            4677999999999999 799998877665556666555544322111          01111222233235999999988


Q ss_pred             EeeeeeecCCCceeEEeeEEeCcCcccCchHHHHHHHHHHHHHHcCCcEEEEEecCCChhhhhhcCceeeCceeeee
Q 031789           75 FIEKKFLRNCGKVGHIEDVVVDASARGMQLGKKIIKFLTDHAHAVGCYKVILDCSLGNKAFYEKCGLKQKGIHMTMY  151 (153)
Q Consensus        75 ~~~~~~~~~~~~~~~i~~~~v~p~~rg~Gig~~ll~~~~~~~~~~g~~~~~~~~~~~n~~~y~k~Gf~~~~~~~~~~  151 (153)
                      ...+.........++|..++|+|+|||+|+|++|++.++++|++.|+..+++.+++.|++||+|+||+..|..|..+
T Consensus        80 ~~~~~~~~~~~~~~~i~~l~v~p~~rg~Gig~~L~~~~~~~a~~~g~~~i~l~~~~~~~~~Y~k~GF~~~g~~m~~r  156 (157)
T d1i12a_          80 IIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQIR  156 (157)
T ss_dssp             EEEECSHHHHCEEEEEEEEEECGGGTTSSHHHHHHHHHHHHHHHTTCSEEEEEECGGGHHHHHHTTCEEEEEEEEEE
T ss_pred             eccccccccCcceeEEEEEEecHhhcCCCchHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHhCCCEEeeEEEEEc
Confidence            76655444446788999999999999999999999999999999999999999999999999999999999998754
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} Back     information, alignment and structure
>d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1iyka2 d.108.1.2 (A:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1iica2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxta2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} Back     information, alignment and structure
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lrza2 d.108.1.4 (A:1-165) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2hqya1 d.108.1.4 (A:135-298) Hypothetical protein BT3689 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2d4pa1 d.108.1.1 (A:1-130) Hypothetical protein TTHA1254 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ne9a1 d.108.1.4 (A:1-164) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} Back     information, alignment and structure