Citrus Sinensis ID: 031792


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MKAETKAKIEGTVREILVKSDMTETTEFQIRKQASEKMGLDLSQPEYKAFVRHKSKEEQEEEEEEENEAVKNDNAEYDDEGNLIICQLNKKRRVTIQDFKGKTLVSIREYYTKGGKELPSAKGISLTEEQWSALRKNVSAIDTAVKKMQSRIM
ccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHcccccHHHHHHHHHHHHHHcccccccccccccEEEEcccEEEEEEEEccccEEEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccc
***********TVREILVKSDMT*********************************************************GNLIICQLNKKRRVTIQDFKGKTLVSIREYYTKGGK**P***GISLTEEQWSALRKNVSAIDTAVKKMQS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAETKAKIEGTVREILVKSDMTETTEFQIRKQASEKMGLDLSQPEYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGNLIICQLNKKRRVTIQDFKGKTLVSIREYYTKGGKELPSAKGISLTEEQWSALRKNVSAIDTAVKKMQSRIM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA polymerase II transcriptional coactivator KELP General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. Binds single-stranded DNA.probableO65155

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AGH, chain A
Confidence level:very confident
Coverage over the Query: 74-151
View the alignment between query and template
View the model in PyMOL
Template: 1Q1V, chain A
Confidence level:confident
Coverage over the Query: 3-57
View the alignment between query and template
View the model in PyMOL