Citrus Sinensis ID: 031855


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MIFINIERILFFFKLHLQWVVQGAVDVDIGANPSAEGADEDEGVDDQAVKVVDIVDTFRLQEQPAFDKKQFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYIADALKEVKC
cEEEEEccEEEEEEEEEEEEEEcccccccccccccccccccccccccEEEEccEEEEccCECcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEcccccccCEEEEEcccccEEcc
*IFINIERILFFFKLHLQWVVQGAVDVDIGAN**************QAVKVVDIVDTFRLQEQPAFDKKQFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYIADALKEVKC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFINIERILFFFKLHLQWVVQGAVDVDIGANPSAEGADEDEGVDDQAVKVVDIVDTFRLQEQPAFDKKQFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYIADALKEVKC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Translationally-controlled tumor protein homolog Involved in calcium binding and microtubule stabilization.confidentP35681
Translationally-controlled tumor protein homolog Involved in calcium binding and microtubule stabilization.confidentP31265
Translationally-controlled tumor protein homolog Involved in calcium binding and microtubule stabilization.probableO03992

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KWB, chain A
Confidence level:very confident
Coverage over the Query: 2-152
View the alignment between query and template
View the model in PyMOL