Citrus Sinensis ID: 031890


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MDSYRQEKVQKFEEFVDRRLKPDLTRAIAERDKVFEQQKIFSDLRKNIENLEKNSVTSLRTLVNLGSEVYMQADVPDTQHIFVDIGLGFHVEFTWSEALKFISQREDKIARQIDEYTRLIASIKAQIKLVCEGICELLQLPAETSVQEAIF
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEcccCEEEEEECccccEEEEEEcccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHcc
******E***KFEEFVDRRLKPDLTRAIAERDKVFEQQKIFSDLRKNIENLEKNSVTSLRTLVNLGSEVYMQADVPDTQHIFVDIGLGFHVEFTWSEALKFISQREDKIARQIDEYTRLIASIKAQIKLVCEGICELLQLP**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSYRQEKVQKFEEFVDRRLKPDLTRAIAERDKxxxxxxxxxxxxxxxxxxxxxSVTSLRTLVNLGSEVYMQADVPDTQHIFVDIGLGFHVEFTWSEALKFISQREDKIARQIDEYTRLIASIKAQIKLVCEGICELLQLPAETSVQEAIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein UXT Involved in gene transcription regulation. Acts in concert with the corepressor URI1 to regulate androgen receptor (AR) transcription. AR N-terminus-associated coactivator which may play a role in facilitating receptor-induced transcriptional activation. Potential component of mitochondrial-associated LRPPRC, a multidomain organizer that potentially integrates mitochondria and the microtubular cytoskeleton with chromosome remodeling. Increasing concentrations of UXT contributes to progressive aggregation of mitochondria and cell death potentially through its association with LRPPRC. May be a nuclear chaperone that promotes formation of the NF-kappa-B enhanceosome and which is essential for its nuclear function. Suppresses cell transformation and it might mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like MECOM. Together with URI1, associates with chromatin to the NKX3-1 promoter region.probableQ63ZY7
Protein UXT Involved in gene transcription regulation. Acts in concert with the corepressor URI1 to regulate androgen receptor (AR) transcription. AR N-terminus-associated coactivator which may play a role in facilitating receptor-induced transcriptional activation. Potential component of mitochondrial-associated LRPPRC, a multidomain organizer that potentially integrates mitochondria and the microtubular cytoskeleton with chromosome remodeling. Increasing concentrations of UXT contributes to progressive aggregation of mitochondria and cell death potentially through its association with LRPPRC. May be a nuclear chaperone that promotes formation of the NF-kappa-B enhanceosome and which is essential for its nuclear function. Suppresses cell transformation and it might mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like MECOM. Together with URI1, associates with chromatin to the NKX3-1 promoter region.probableQ32P97
Protein UXT Involved in gene transcription regulation. Acts in concert with the corepressor URI1 to regulate androgen receptor (AR) transcription. AR N-terminus-associated coactivator which may play a role in facilitating receptor-induced transcriptional activation. Potential component of mitochondrial-associated LRPPRC, a multidomain organizer that potentially integrates mitochondria and the microtubular cytoskeleton with chromosome remodeling. Increasing concentrations of UXT contributes to progressive aggregation of mitochondria and cell death potentially through its association with LRPPRC. May be a nuclear chaperone that promotes formation of the NF-kappa-B enhanceosome and which is essential for its nuclear function. Suppresses cell transformation and it might mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like MECOM. Together with URI1, associates with chromatin to the NKX3-1 promoter region.probableQ9WTZ0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZDI, chain C
Confidence level:confident
Coverage over the Query: 4-143
View the alignment between query and template
View the model in PyMOL