Citrus Sinensis ID: 031916


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MNSSSYPNQKFDHQHVATGVPVAGFQQQHANVHQLVEGPWSSGLCDCFSDCSTCCLTCWCPCITFGRIADIVDKGSSSCSVSGALYLVISLVTGCGCLYSSCYRSKMRQQYMLKGGPCGDCLAHFCCDTCALSQEYRELKARGFDMSLGN
cccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccHHHHHHHHHcccccccccccHHHHccHHHHHHHHHHHHHHccccccccc
***************************************WSSGLCDCFSDCSTCCLTCWCPCITFGRIADIVDKGSSSCSVSGALYLVISLVTGCGCLYSSCYRSKMRQQYMLKGGPCGDCLAHFCCDTCALSQEYRELKARGF******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSSSYPNQKFDHQHVATGVPVAGFQQQHANVHQLVEGPWSSGLCDCFSDCSTCCLTCWCPCITFGRIADIVDKGSSSCSVSGALYLVISLVTGCGCLYSSCYRSKMRQQYMLKGGPCGDCLAHFCCDTCALSQEYRELKARGFDMSLGN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein PLANT CADMIUM RESISTANCE 2 Zinc transporter acting in both zinc extrusion and long-distance zinc transport. Involved in the loading of zinc into the xyleme and in the detoxification of excess zinc at the epidermal cells. Acts independently from the zinc transporters HMA2 and HMA4. May be also involved in cadmium resistance.probableQ9LQU4
Cell number regulator 9 probableD9HP25
Cell number regulator 10 probableD9HP26

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1kil, chain Eprobable Alignment | Template Structure