Citrus Sinensis ID: 031919

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MVISSSLALSLSSSSSFLSTRPPSPHFLSLSSSRSSFFTNLKTNSLVVGPRGGSGKGRKGFTCYALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFESELKKEPDSETDPPGEKPTAISEERKDEGKISSSKESV
cccccccHHccccccccccccccccccccccccccccccccccccEEccccccccccccccEEEEcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHccccccccccccc
****************************************LKTNSLVVG******KGRKGFTCYALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVK************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVISSSLALSLSSSSSFLSTRPPSPHFLSLSSSRSSFFTNLKTNSLVVGPRGGSGKGRKGFTCYALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTVKSFQQAAKEFESELKKEPDSETDPPGEKPTAISEERKDEGKISSSKESV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sec-independent protein translocase protein TATA, chloroplastic Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across the thylakoid membrane. Involved in delta pH-dependent protein transport required for chloroplast development, especially thylakoid membrane formation. TATC and TATB mediate precursor recognition, whereas TATA facilitates translocation.probableQ75GK3
Sec-independent protein translocase protein TATA, chloroplastic Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across the thylakoid membrane. Involved in delta pH-dependent protein transport required for chloroplast development, especially thylakoid membrane formation. TATC and TATB mediate precursor recognition, whereas TATA facilitates translocation.probableQ9LKU2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L16, chain A
Confidence level:very confident
Coverage over the Query: 65-116
View the alignment between query and template
View the model in PyMOL