Citrus Sinensis ID: 031926

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150

MGKAKKAPKFAAMKKIITKRAIKNYKEDVLNPNKKDLTKEKMPRNVPNVSSALFFTHNTALGPPYRVLVDTNFINFSIQNKLDLEKGMMDCLYAKCTPCITDCVMAELEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVERVTQV

cccccccccHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHccccccCEEEEEHHHHHHHHHccccHHHHHHHHHccccCEECHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccHHHHHHHHHcc

****KKAPKFAAMKKIITKRAIKNY***********************VSSALFFTHNTALGPPYRVLVDTNFINFSIQNKLDLEKGMMDCLYAKCTPCITDCVMAELEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVERVTQ*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGKAKKAPKFAAMKKIITKRAIKNYKEDVLNPNKKDLTKEKMPRNVPNVSSALFFTHNTALGPPYRVLVDTNFINFSIQNKLDLEKGMMDCLYAKCTPCITDCVMAELEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVERVTQV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
rRNA-processing protein FCF1 homolog	Essential protein involved in pre-rRNA processing and 40S ribosomal subunit assembly.	probable	Q55GM5
rRNA-processing protein FCF1 homolog	Essential protein involved in pre-rRNA processing and 40S ribosomal subunit assembly.	probable	Q9Y324
rRNA-processing protein FCF1 homolog	Essential protein involved in pre-rRNA processing and 40S ribosomal subunit assembly.	probable	Q9CTH6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1O4W, chain A
Confidence level:very confident
Coverage over the Query: 64-149
View the alignment between query and template
View the model in PyMOL