Citrus Sinensis ID: 031940

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150

MAGEEDGEFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEVFLTPAVLRECRRIISESEIMKEDDNNWPEPDRVGRQELEIVMGNEHISFTTSKIGSLVDVQSSKDPEGLRIFYYLVQDLKCFVFSLISLHFKIKPI

ccccccccEEEEEEccccccccEEEEEEEEccccEEEEEcccccccccEEEEEEEEcHHHHHHHHHHHHccccccccccccccccccccEEEEEEEccEEEEEEEcccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHEEEEECcc

******GEFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEVFLTPAVLRECRRIISESEIMKEDDNNWPEPDRVGRQELEIVMGNEHISFTTSKIGSLVDVQSSKDPEGLRIFYYLVQDLKCFVFSLISLHFKIKPI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAGEEDGEFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEVFLTPAVLRECRRIISESEIMKEDDNNWPEPDRVGRQELEIVMGNEHISFTTSKIGSLVDVQSSKDPEGLRIFYYLVQDLKCFVFSLISLHFKIKPI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein mago nashi homolog		confident	P49030
Protein mago nashi homolog 2	Involved in mRNA splicing and in the nonsense-mediated decay (NMD) pathway.	confident	Q96A72
Protein mago nashi homolog	Involved in hermaphrodite germline sex determination. May allow oogenesis by inhibiting the function of one or more of the masculinizing genes (fog, fem, and gld) which act during the fourth larval stage to promote transient sperm production in the hermaphrodite germline.	confident	P49029

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OO0, chain A
Confidence level:very confident
Coverage over the Query: 7-150
View the alignment between query and template
View the model in PyMOL