Citrus Sinensis ID: 031963


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MNDSHMLDPPPTKNGTGEMMMHLHKKMKMHMTFYWGNEAEVLFSGWPGKRAGMYALALIFVFTLGVIAEWLTHSRLIKEGTTNVAARIIRTILHAIRVSLGYLLMLSLMSFNAGIFLAAVAGQALGFLLFGSMVFDKTEFPPYEKPSESC
ccccccccccccccccccccccccccccEEEEEEcccCEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc
************************KKMKMHMTFYWGNEAEVLFSGWPGKRAGMYALALIFVFTLGVIAEWLTHSRLIKEGTTNVAARIIRTILHAIRVSLGYLLMLSLMSFNAGIFLAAVAGQALGFLLFGSMVFDKT************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDSHMLDPPPTKNGTGEMMMHLHKKMKMHMTFYWGNEAEVLFSGWPGKRAGMYALALIFVFTLGVIAEWLTHSRLIKEGTTNVAARIIRTILHAIRVSLGYLLMLSLMSFNAGIFLAAVAGQALGFLLFGSMVFDKTEFPPYEKPSESC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Copper transporter 1 Copper transporter involved in copper acquisition and transport in leaves. Required for copper homeostasis and normal plant growth and development.probableQ39065

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LS3, chain A
Confidence level:probable
Coverage over the Query: 86-113
View the alignment between query and template
View the model in PyMOL
Template: 2LS2, chain A
Confidence level:probable
Coverage over the Query: 49-72
View the alignment between query and template
View the model in PyMOL
Template: 2LS4, chain A
Confidence level:probable
Coverage over the Query: 111-134
View the alignment between query and template
View the model in PyMOL