Citrus Sinensis ID: 031966


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MLLTRSNRAKLPIKKRLASDVFECKTCNRQFPSFQALGGHRASHKKPRLINGETKTLSSTTATKPKLHECSICGQEFAMGQALGGHMRRHRIAMNESLNSAVIVSQSPPVLRRSNSSRRVFGLDLNLTPLENDLEVLFGKMAPKVDLLMT
cccccccccccccccccccccEEcccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MLL***************SDVFECKTCNRQFPSFQA******************************LHECSICGQEFAMGQALGGHMRRHRI**************************RVFGLDLNLTPLENDLEVLFGKMAPKVDLLMT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLTRSNRAKLPIKKRLASDVFECKTCNRQFPSFQALGGHRASHKKPRLINGETKTLSSTTATKPKLHECSICGQEFAMGQALGGHMRRHRIAMNESLNSAVIVSQSPPVLRRSNSSRRVFGLDLNLTPLENDLEVLFGKMAPKVDLLMT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger protein ZAT11 Probable transcription factor that may be involved in stress responses.probableQ9SLD4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NJQ, chain A
Confidence level:very confident
Coverage over the Query: 17-52
View the alignment between query and template
View the model in PyMOL
Template: 1NJQ, chain A
Confidence level:very confident
Coverage over the Query: 63-97
View the alignment between query and template
View the model in PyMOL
Template: 2DLQ, chain A
Confidence level:confident
Coverage over the Query: 17-110
View the alignment between query and template
View the model in PyMOL