Citrus Sinensis ID: 032012


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MPFSSYLSKFPLYLPRPHGSRFESDVYVNSWDPTISKLLVSISTLCNQRKMYLLRSDVKSGRRNEAWISYNSSTHNPSVAFTGFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVDFVIFSIYSWEFNSSLEMDDETTNHVSNPKR
ccccccccccccccccccEEEEEEEcccccccccccEEEEEcccccEEEEEEccccccccccEEEEEEEEccccccEEEEEEcccccccEEcccEEEEEcccccccEEEEEEEEEcccccEEEEEEEEEEEEccccccccccccccccc
ccccccccccccccccccEEEEEEEccccccccccccEEEEcccEEEEcEEEEcccccccccEEEEEEEEEccccEEEEEEEccccccccccEEEEEccHHHHcccEEEEEEEEEEcccEEEEEEEEEEEEcccccccccccccccccc
mpfssylskfplylprphgsrfesdvyvnswdpTISKLLVSISTLCNQRKmyllrsdvksgrrnEAWISYnssthnpsvaftgfrnnsVVMQGLGYqvdlrqhlpefvtfgfsmetRVDFVIFSIYSWefnsslemddettnhvsnpkr
MPFSSYLSKFPLYLPRPHGSRFESDVYVNSWDPTISKLLVSISTLCNQRKMYLlrsdvksgrrNEAWISynssthnpsvAFTGFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVDFVIFSIYSWEfnsslemddettnhvsnpkr
MPFSSYLSKFPLYLPRPHGSRFESDVYVNSWDPTISKLLVSISTLCNQRKMYLLRSDVKSGRRNEAWISYNSSTHNPSVAFTGFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVDFVIFSIYSWEFNSSLEMDDETTNHVSNPKR
******LSKFPLYLPRPHGSRFESDVYVNSWDPTISKLLVSISTLCNQRKMYLLRSDVKSGRRNEAWISYNSSTHNPSVAFTGFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVDFVIFSIYSWEFN******************
MPFSSYLSKFPLYLPRPHGSRFESDVYVNSWDPTISKLLVSISTLCNQRKMYLLRSDVKSGRRNEAWISYNSSTHNPSVAFTGFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVDFVIFSIYSWEF*******************
MPFSSYLSKFPLYLPRPHGSRFESDVYVNSWDPTISKLLVSISTLCNQRKMYLLRSDVKSGRRNEAWISYNSSTHNPSVAFTGFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVDFVIFSIYSWEFNSSLEM*************
MPFSSYLSKFPLYLPRPHGSRFESDVYVNSWDPTISKLLVSISTLCNQRKMYLLRSDVKSGRRNEAWISYNSSTHNPSVAFTGFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVDFVIFSIYSWEFNSS****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPFSSYLSKFPLYLPRPHGSRFESDVYVNSWDPTISKLLVSISTLCNQRKMYLLRSDVKSGRRNEAWISYNSSTHNPSVAFTGFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVDFVIFSIYSWEFNSSLEMDDETTNHVSNPKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query149 2.2.26 [Sep-21-2011]
Q39529290 Agglutinin-2 OS=Cladrasti N/A no 0.738 0.379 0.333 2e-06
P16270265 Non-seed lectin OS=Pisum N/A no 0.718 0.403 0.298 1e-05
P81371240 Seed lectin OS=Vatairea m N/A no 0.771 0.479 0.252 7e-05
Q93X49275 Lectin OS=Lens culinaris N/A no 0.738 0.4 0.290 9e-05
P02870275 Lectin OS=Lens culinaris N/A no 0.738 0.4 0.290 0.0001
Q93WH6275 Lectin OS=Lens culinaris N/A no 0.738 0.4 0.290 0.0001
Q8VXF2275 Lectin OS=Lens culinaris N/A no 0.738 0.4 0.290 0.0001
P93535292 Seed lectin OS=Styphnolob N/A no 0.731 0.373 0.264 0.0001
P05045275 Seed lectin subunit I OS= N/A no 0.765 0.414 0.277 0.0002
Q40987270 Nodule lectin OS=Pisum sa N/A no 0.771 0.425 0.296 0.0002
>sp|Q39529|LEC2_CLAKE Agglutinin-2 OS=Cladrastis kentukea PE=1 SV=1 Back     alignment and function desciption
 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 23  ESDVYVNS-WDPTISKLLVSISTLCNQRKMYLLRSDVKSGRRNEAWISYNSSTHNPSVAF 81
           E D +VN+ WDP+   + + ++T+   +    +R   ++G    A ISYNS T   SV  
Sbjct: 165 EFDTFVNNNWDPSHRHIGIDVNTI---KSSATVRWQRENGSLATAQISYNSDTKKLSVVS 221

Query: 82  TGFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVDFVIFSIYSWEFNSSLE 135
           +     +     + Y VDL+  LPE+V  GFS  T       +I SW FNS+L+
Sbjct: 222 SYPNTQANEDYTVSYDVDLKTELPEWVRVGFSGSTGGYVQNHNILSWTFNSNLQ 275




Bark lectins are storage proteins that probably maintain stocks of nitrogen during dormant period. Self-aggregatable molecules that can bind their own carbohydrate side chains. They could also play a role in the plant's defense against phytophagous invertebrates or herbivorous higher animals.
Cladrastis kentukea (taxid: 38412)
>sp|P16270|LECN_PEA Non-seed lectin OS=Pisum sativum PE=2 SV=2 Back     alignment and function description
>sp|P81371|LECS_VATMA Seed lectin OS=Vatairea macrocarpa PE=1 SV=1 Back     alignment and function description
>sp|Q93X49|LEC_LENCO Lectin OS=Lens culinaris subsp. orientalis PE=3 SV=2 Back     alignment and function description
>sp|P02870|LEC_LENCU Lectin OS=Lens culinaris PE=1 SV=2 Back     alignment and function description
>sp|Q93WH6|LEC_LENCC Lectin OS=Lens culinaris subsp. culinaris PE=3 SV=2 Back     alignment and function description
>sp|Q8VXF2|LEC_LENCT Lectin OS=Lens culinaris subsp. tomentosus PE=3 SV=2 Back     alignment and function description
>sp|P93535|LECS_STYJP Seed lectin OS=Styphnolobium japonicum PE=2 SV=1 Back     alignment and function description
>sp|P05045|LEC1_DOLBI Seed lectin subunit I OS=Dolichos biflorus PE=1 SV=2 Back     alignment and function description
>sp|Q40987|LECR_PEA Nodule lectin OS=Pisum sativum GN=NLEC1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
224092745 681 predicted protein [Populus trichocarpa] 0.805 0.176 0.504 7e-24
225470605 720 PREDICTED: L-type lectin-domain containi 0.899 0.186 0.470 3e-23
224096774 713 predicted protein [Populus trichocarpa] 0.812 0.169 0.483 1e-22
224059892 613 predicted protein [Populus trichocarpa] 0.812 0.197 0.459 2e-21
449479044 678 PREDICTED: L-type lectin-domain containi 0.791 0.174 0.428 6e-21
449438590 665 PREDICTED: LOW QUALITY PROTEIN: L-type l 0.791 0.177 0.428 1e-20
296088135 546 unnamed protein product [Vitis vinifera] 0.885 0.241 0.442 2e-20
356527993 709 PREDICTED: L-type lectin-domain containi 0.845 0.177 0.433 4e-20
224056347 615 predicted protein [Populus trichocarpa] 0.771 0.186 0.495 5e-20
356527997 709 PREDICTED: L-type lectin-domain containi 0.845 0.177 0.425 1e-19
>gi|224092745|ref|XP_002334872.1| predicted protein [Populus trichocarpa] gi|222831889|gb|EEE70366.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 82/121 (67%), Gaps = 1/121 (0%)

Query: 18  HGSRFESDVYVNSWDPTISKLLVSISTLCNQRKMYLLRSDVKSGRRNEAWISYNSSTHNP 77
           H    E D++ N +DP    + + I+++ +   +  L  D++ GRR EAWISYNSSTHN 
Sbjct: 145 HFVAVEFDIFQNYFDPPGEHVGIDINSMQSVNNITWL-CDIRRGRRTEAWISYNSSTHNL 203

Query: 78  SVAFTGFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVDFVIFSIYSWEFNSSLEMD 137
           SVAFTG+RNN+V MQ L   V LR +LPE V+FGFS  T   F I ++YSW+F+SSLE+D
Sbjct: 204 SVAFTGYRNNTVEMQFLSQIVSLRDYLPERVSFGFSASTGDLFAIHTLYSWDFSSSLEID 263

Query: 138 D 138
           D
Sbjct: 264 D 264




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225470605|ref|XP_002262748.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224096774|ref|XP_002334671.1| predicted protein [Populus trichocarpa] gi|222874064|gb|EEF11195.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224059892|ref|XP_002300009.1| predicted protein [Populus trichocarpa] gi|222847267|gb|EEE84814.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449479044|ref|XP_004155489.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449438590|ref|XP_004137071.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|296088135|emb|CBI35556.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356527993|ref|XP_003532590.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Back     alignment and taxonomy information
>gi|224056347|ref|XP_002298814.1| predicted protein [Populus trichocarpa] gi|222846072|gb|EEE83619.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356527997|ref|XP_003532592.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
UNIPROTKB|P02870275 P02870 "Lectin" [Lens culinari 0.738 0.4 0.290 7.9e-08
UNIPROTKB|Q40987270 NLEC1 "Nodule lectin" [Pisum s 0.765 0.422 0.298 7.6e-07
UNIPROTKB|P81637 237 P81637 "Lectin alpha chain" [D 0.771 0.485 0.315 1.9e-06
UNIPROTKB|P83721 234 P83721 "Mannose/glucose-specif 0.697 0.444 0.330 2.5e-06
UNIPROTKB|P58907 237 P58907 "Lectin alpha chain" [D 0.771 0.485 0.315 2.5e-06
UNIPROTKB|P81517 236 P81517 "Lectin alpha chain" [C 0.718 0.453 0.321 3.2e-06
UNIPROTKB|B3EWJ2 237 B3EWJ2 "Lectin alpha chain" [D 0.771 0.485 0.307 4.2e-06
UNIPROTKB|P08902 237 P08902 "Lectin alpha chain" [D 0.771 0.485 0.307 4.2e-06
TAIR|locus:2142499 651 AT5G10530 [Arabidopsis thalian 0.778 0.178 0.310 2.4e-05
UNIPROTKB|P58908 237 P58908 "Lectin alpha chain" [D 0.704 0.443 0.316 2.8e-05
UNIPROTKB|P02870 P02870 "Lectin" [Lens culinaris (taxid:3864)] Back     alignment and assigned GO terms
 Score = 127 (49.8 bits), Expect = 7.9e-08, P = 7.9e-08
 Identities = 34/117 (29%), Positives = 58/117 (49%)

Query:    23 ESDVYVNS-WDPTISKLLVSISTLCNQRKMYLLRS-DVKSGRRNEAWISYNSSTHNPSVA 80
             E D + N+ WDP+  +  + I    N  K    +S ++++G R    I++N++T+  +V 
Sbjct:   149 EFDTFYNAAWDPSNKERHIGIDV--NSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVT 206

Query:    81 FT---GFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVDFVIFSIYSWEFNSSL 134
              T        +V    L   V L+  +PE+V  GFS  T  +F    ++SW F+S L
Sbjct:   207 LTYPNSLEEENVTSYTLNEVVPLKDVVPEWVRIGFSATTGAEFAAHEVHSWSFHSEL 263




GO:0005509 "calcium ion binding" evidence=IDA
GO:0009756 "carbohydrate mediated signaling" evidence=TAS
GO:0030145 "manganese ion binding" evidence=IDA
GO:0030246 "carbohydrate binding" evidence=IDA
UNIPROTKB|Q40987 NLEC1 "Nodule lectin" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms
UNIPROTKB|P81637 P81637 "Lectin alpha chain" [Dioclea guianensis (taxid:99571)] Back     alignment and assigned GO terms
UNIPROTKB|P83721 P83721 "Mannose/glucose-specific lectin Cramoll" [Cratylia mollis (taxid:252530)] Back     alignment and assigned GO terms
UNIPROTKB|P58907 P58907 "Lectin alpha chain" [Dioclea virgata (taxid:167618)] Back     alignment and assigned GO terms
UNIPROTKB|P81517 P81517 "Lectin alpha chain" [Cratylia argentea (taxid:83131)] Back     alignment and assigned GO terms
UNIPROTKB|B3EWJ2 B3EWJ2 "Lectin alpha chain" [Dioclea sclerocarpa (taxid:1176036)] Back     alignment and assigned GO terms
UNIPROTKB|P08902 P08902 "Lectin alpha chain" [Dioclea grandiflora (taxid:3837)] Back     alignment and assigned GO terms
TAIR|locus:2142499 AT5G10530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P58908 P58908 "Lectin alpha chain" [Dioclea rostrata (taxid:192416)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
cd06899236 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume 5e-13
pfam00139231 pfam00139, Lectin_legB, Legume lectin domain 3e-05
>gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information
 Score = 63.4 bits (155), Expect = 5e-13
 Identities = 29/76 (38%), Positives = 38/76 (50%)

Query: 59  KSGRRNEAWISYNSSTHNPSVAFTGFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRV 118
           KSG+  +AWI Y+SS+   SV              L Y VDL + LPE V  GFS  T +
Sbjct: 161 KSGKPMQAWIDYDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGL 220

Query: 119 DFVIFSIYSWEFNSSL 134
              +  I SW F+S+ 
Sbjct: 221 LTELHYILSWSFSSNG 236


This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by binding glycans on the cell surface. Medically, PHA is used as a mitogen to trigger cell division in T-lymphocytes and to activate latent HIV-1 from human peripheral lymphocytes. Plant L-type lectins are primarily found in the seeds of leguminous plants where they constitute about 10% of the total soluble protein of the seed extracts. They are synthesized during seed development several weeks after flowering and transported to the vacuole where they become condensed into specialized vesicles called protein bodies. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely. Length = 236

>gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 149
cd06899236 lectin_legume_LecRK_Arcelin_ConA legume lectins, l 100.0
PF00139236 Lectin_legB: Legume lectin domain; InterPro: IPR00 100.0
cd01951223 lectin_L-type legume lectins. The L-type (legume-t 99.96
cd07308218 lectin_leg-like legume-like lectins: ERGIC-53, ERG 99.23
cd06902225 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran 98.79
cd06903215 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem 98.03
cd06901248 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr 97.79
PF03388229 Lectin_leg-like: Legume-like lectin family; InterP 97.74
KOG3838 497 consensus Mannose lectin ERGIC-53, involved in gly 96.9
cd06900255 lectin_VcfQ VcfQ bacterial pilus biogenesis protei 94.49
KOG3839351 consensus Lectin VIP36, involved in the transport 91.78
>cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information
Probab=100.00  E-value=4.9e-39  Score=258.19  Aligned_cols=131  Identities=31%  Similarity=0.413  Sum_probs=118.7

Q ss_pred             CCCcccCCCC---CCCCCCEEEEEEeCccCC-C-CCCCCceeeecCccccccccccc--ccccCCCceeEEEEEEeCCCC
Q 032012            3 FSSYLSKFPL---YLPRPHGSRFESDVYVNS-W-DPTISKLLVSISTLCNQRKMYLL--RSDVKSGRRNEAWISYNSSTH   75 (149)
Q Consensus         3 ~~~yLGl~~~---~~~~~~~vAVEFDT~~n~-~-Dp~~nHVgIdins~~S~~~~~~~--~~~l~~G~~~~awI~Yd~~~~   75 (149)
                      .|+||||++.   +.+.++.|||||||++|. + ||+.|||||++|++.|..+..|.  ...|.+|+.++|||+||+.++
T Consensus        98 ~G~~lG~~~~~~~~~~~~~~vAVEFDT~~n~~~~D~~~nHigIdvn~~~S~~~~~~~~~~~~l~~g~~~~v~I~Y~~~~~  177 (236)
T cd06899          98 SGGYLGLFNSSNNGNSSNHIVAVEFDTFQNPEFGDPDDNHVGIDVNSLVSVKAGYWDDDGGKLKSGKPMQAWIDYDSSSK  177 (236)
T ss_pred             CcceeeeecCCCCCCcccceEEEEeecccCcccCCCCCCeEEEEcCCcccceeeccccccccccCCCeEEEEEEEcCCCC
Confidence            5899999983   346889999999999998 4 99999999999999888877763  234689999999999999999


Q ss_pred             ceEEEEEcCCCCCcccceeEEEecCCcCCCCceEEEEEeecCCCcceeEEEEEEEEeC
Q 032012           76 NPSVAFTGFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVDFVIFSIYSWEFNSS  133 (149)
Q Consensus        76 ~L~V~l~~~~~~~p~~p~Ls~~vdLs~~L~~~v~vGFSasTG~~~~~h~I~sWsF~s~  133 (149)
                      +|+|+|......+|..|+|++.+||+.+|+++|||||||+||...|.|+|++|+|+++
T Consensus       178 ~L~V~l~~~~~~~~~~~~ls~~vdL~~~l~~~~~vGFSasTG~~~~~h~i~sWsF~s~  235 (236)
T cd06899         178 RLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWSFSSN  235 (236)
T ss_pred             EEEEEEEeCCCCCCcCCEEEEeccHHHhCCCceEEEEEeEcCCCcceEEEEEEEEEcC
Confidence            9999999887667889999999999999999999999999999999999999999876



This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin

>PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported Back     alignment and domain information
>cd01951 lectin_L-type legume lectins Back     alignment and domain information
>cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information
>cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain Back     alignment and domain information
>PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates Back     alignment and domain information
>KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain Back     alignment and domain information
>KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
1n3o_A252 Pterocarcpus Angolensis Lectin In Complex With Alph 2e-06
1q8o_A252 Pterocartpus Angolensis Lectin Pal In Complex With 2e-06
1mvq_A 236 Cratylia Mollis Lectin (Isoform 1) In Complex With 9e-06
1n47_A233 Isolectin B4 From Vicia Villosa In Complex With The 1e-05
1fat_A252 Phytohemagglutinin-L Length = 252 2e-05
1bjq_A253 The Dolichos Biflorus Seed Lectin In Complex With A 2e-05
3u4x_A 236 Crystal Structure Of A Lectin From Camptosema Pedic 2e-05
3zvx_A261 Structure Of The Lectin From Platypodium Elegans In 3e-05
1h9w_A 237 Native Dioclea Guianensis Seed Lectin Length = 237 3e-05
1h9p_A 237 Crystal Structure Of Dioclea Guianensis Seed Lectin 4e-05
3rrd_A 237 Native Structure Of Dioclea Virgata Lectin Length = 4e-05
2sba_A253 Soybean Agglutinin Complexed With 2,6-Pentasacchari 5e-05
2d3p_A 236 Cratylia Floribunda Seed Lectin Crystallized At Bas 6e-05
2je7_A 239 Crystal Structure Of Recombinant Dioclea Guianensis 8e-05
2jdz_A 239 Crystal Structure Of Recombinant Dioclea Guianensis 8e-05
1lul_A253 Db58, A Legume Lectin From Dolichos Biflorus Length 8e-05
2bqp_A234 The Structure Of The Pea Lectin-D-Glucopyranose Com 1e-04
1g8w_A233 Improved Structure Of Phytohemagglutinin-L From The 1e-04
1gnz_A257 Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)m 1e-04
2je9_A239 Crystal Structure Of Recombinant Dioclea Grandiflor 1e-04
1hql_A257 The Xenograft Antigen In Complex With The B4 Isolec 2e-04
2gdf_A237 Crystal Structure Of Dioclea Violacea Seed Lectin L 2e-04
3sh3_A237 Crystal Structure Of A Pro-Inflammatory Lectin From 2e-04
2zbj_A 237 Crystal Structure Of Dioclea Rostrata Lectin Length 2e-04
3a0k_A 237 Crystal Structure Of An Antiflamatory Legume Lectin 2e-04
1qnw_A242 Lectin Ii From Ulex Europaeus Length = 242 3e-04
1qmo_E133 Structure Of Fril, A Legume Lectin That Delays Hema 4e-04
2eig_A234 Lotus Tetragonolobus Seed Lectin (Isoform) Length = 5e-04
2jec_A 239 Crystal Structure Of Recombinant Dioclea Grandiflor 5e-04
1wbf_A242 Winged Bean Lectin, Saccharide Free Form Length = 2 7e-04
1wbl_A241 Winged Bean Lectin Complexed With Methyl-Alpha-D-Ga 7e-04
1dgl_A 237 Lectin From Dioclea Grandiflora Complexed To Triman 8e-04
1fay_A238 Winged Bean Acidic Lectin Complexed With Methyl-Alp 9e-04
>pdb|1N3O|A Chain A, Pterocarcpus Angolensis Lectin In Complex With Alpha-Methyl Glucose Length = 252 Back     alignment and structure

Iteration: 1

Score = 48.5 bits (114), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 12/109 (11%) Query: 29 NSWDPTISKLLVSISTLCNQRKMYLLRSDVKSGRRNEAWISYNSSTHNPSVAFT---GFR 85 N+WDP + + ++++ R + ++ D + G+ +++N ST N V T G R Sbjct: 138 NTWDPNYPHIGIDVNSI---RSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTR 194 Query: 86 NNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVDFVIFSIYSWEFNSSL 134 + Y+VD+R LPE+V GFS + + ++ SW F S+L Sbjct: 195 YE------VSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTL 237
>pdb|1Q8O|A Chain A, Pterocartpus Angolensis Lectin Pal In Complex With The Dimmanoside Man(Alpha1-2)man Length = 252 Back     alignment and structure
>pdb|1MVQ|A Chain A, Cratylia Mollis Lectin (Isoform 1) In Complex With Methyl-Alpha-D- Mannose Length = 236 Back     alignment and structure
>pdb|1N47|A Chain A, Isolectin B4 From Vicia Villosa In Complex With The Tn Antigen Length = 233 Back     alignment and structure
>pdb|1FAT|A Chain A, Phytohemagglutinin-L Length = 252 Back     alignment and structure
>pdb|1BJQ|A Chain A, The Dolichos Biflorus Seed Lectin In Complex With Adenine Length = 253 Back     alignment and structure
>pdb|3U4X|A Chain A, Crystal Structure Of A Lectin From Camptosema Pedicellatum Seeds In Complex With 5-Bromo-4-Chloro-3-Indolyl-Alpha-D-Mannose Length = 236 Back     alignment and structure
>pdb|3ZVX|A Chain A, Structure Of The Lectin From Platypodium Elegans In Complex With A Trimannoside Length = 261 Back     alignment and structure
>pdb|1H9W|A Chain A, Native Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|1H9P|A Chain A, Crystal Structure Of Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|3RRD|A Chain A, Native Structure Of Dioclea Virgata Lectin Length = 237 Back     alignment and structure
>pdb|2SBA|A Chain A, Soybean Agglutinin Complexed With 2,6-Pentasaccharide Length = 253 Back     alignment and structure
>pdb|2D3P|A Chain A, Cratylia Floribunda Seed Lectin Crystallized At Basic Ph Length = 236 Back     alignment and structure
>pdb|2JE7|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin S131h Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2JDZ|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|1LUL|A Chain A, Db58, A Legume Lectin From Dolichos Biflorus Length = 253 Back     alignment and structure
>pdb|2BQP|A Chain A, The Structure Of The Pea Lectin-D-Glucopyranose Complex Length = 234 Back     alignment and structure
>pdb|1G8W|A Chain A, Improved Structure Of Phytohemagglutinin-L From The Kidney Bean Length = 233 Back     alignment and structure
>pdb|1GNZ|A Chain A, Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)metal Free Form Length = 257 Back     alignment and structure
>pdb|2JE9|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|1HQL|A Chain A, The Xenograft Antigen In Complex With The B4 Isolectin Of Griffonia Simplicifolia Lectin-1 Length = 257 Back     alignment and structure
>pdb|2GDF|A Chain A, Crystal Structure Of Dioclea Violacea Seed Lectin Length = 237 Back     alignment and structure
>pdb|3SH3|A Chain A, Crystal Structure Of A Pro-Inflammatory Lectin From The Seeds Of Dioclea Wilsonii Standl Length = 237 Back     alignment and structure
>pdb|2ZBJ|A Chain A, Crystal Structure Of Dioclea Rostrata Lectin Length = 237 Back     alignment and structure
>pdb|3A0K|A Chain A, Crystal Structure Of An Antiflamatory Legume Lectin From Cymbosema Roseum Seeds Length = 237 Back     alignment and structure
>pdb|1QNW|A Chain A, Lectin Ii From Ulex Europaeus Length = 242 Back     alignment and structure
>pdb|1QMO|E Chain E, Structure Of Fril, A Legume Lectin That Delays Hematopoietic Progenitor Maturation Length = 133 Back     alignment and structure
>pdb|2EIG|A Chain A, Lotus Tetragonolobus Seed Lectin (Isoform) Length = 234 Back     alignment and structure
>pdb|2JEC|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Mutant E123a-H131n-K132q Complexed With 5-Bromo-4-Chloro-3- Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|1WBF|A Chain A, Winged Bean Lectin, Saccharide Free Form Length = 242 Back     alignment and structure
>pdb|1WBL|A Chain A, Winged Bean Lectin Complexed With Methyl-Alpha-D-Galactose Length = 241 Back     alignment and structure
>pdb|1DGL|A Chain A, Lectin From Dioclea Grandiflora Complexed To Trimannoside Length = 237 Back     alignment and structure
>pdb|1FAY|A Chain A, Winged Bean Acidic Lectin Complexed With Methyl-Alpha-D-Galactose (Monoclinic Form) Length = 238 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 5e-11
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 2e-10
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 4e-10
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 4e-10
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 4e-10
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 5e-10
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 5e-10
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 8e-10
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 2e-09
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 2e-09
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 3e-09
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 4e-09
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 4e-09
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 1e-08
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 2e-08
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 2e-08
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 3e-08
1nls_A 237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 3e-08
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 3e-08
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 4e-08
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 5e-08
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 7e-08
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 9e-08
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 1e-07
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 2e-07
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 133 Back     alignment and structure
 Score = 55.9 bits (134), Expect = 5e-11
 Identities = 32/118 (27%), Positives = 51/118 (43%), Gaps = 4/118 (3%)

Query: 25  DVYVNSWDPTISKLLVSISTLCNQRKMYLLRSDVKSGRRNEAWISYNSSTHNPSVAFTGF 84
           D Y+N      + + + I  + + R     + D ++G+   A ISYNS +   SV     
Sbjct: 9   DTYLNPDYGDPNYIHIGID-VNSIRSKVTAKWDWQNGKIATAHISYNSVSKRLSVTSYYA 67

Query: 85  RNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVDFVIFSIYSWEFNSSLEMDDETTN 142
            +       L Y ++L   LPE+V  G S  T  D    +++SW F SSL  +     
Sbjct: 68  GSKPAT---LSYDIELHTVLPEWVRVGLSASTGQDKERNTVHSWSFTSSLWTNVAKKE 122


>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Length = 52 Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
3ujo_A281 Legume lectin; carbohydrate-binding, galactose, ad 100.0
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 100.0
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 100.0
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 100.0
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 100.0
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 100.0
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 100.0
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 100.0
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 100.0
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 100.0
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 100.0
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 100.0
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 100.0
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 100.0
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 100.0
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 100.0
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 100.0
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 100.0
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 100.0
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 100.0
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 100.0
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 100.0
1nls_A 237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 100.0
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 100.0
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 100.0
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 99.94
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 99.92
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 99.91
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 99.71
2a6y_A256 EMP47P (FORM1); beta sandwich, carbohydrate bindin 99.68
2a6z_A222 EMP47P (FORM2); beta sandwich, carbohydrate bindin 98.98
2a6v_A226 EMP46P; beta sandwich, carbohydrate binding protei 97.97
>3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* Back     alignment and structure
Probab=100.00  E-value=2.1e-44  Score=295.33  Aligned_cols=131  Identities=26%  Similarity=0.417  Sum_probs=119.7

Q ss_pred             CCCcccCCC--CCCCCCCEEEEEEeCccCC-CCCCCCceeeecCcccccccccccccccCCCceeEEEEEEeCCCCceEE
Q 032012            3 FSSYLSKFP--LYLPRPHGSRFESDVYVNS-WDPTISKLLVSISTLCNQRKMYLLRSDVKSGRRNEAWISYNSSTHNPSV   79 (149)
Q Consensus         3 ~~~yLGl~~--~~~~~~~~vAVEFDT~~n~-~Dp~~nHVgIdins~~S~~~~~~~~~~l~~G~~~~awI~Yd~~~~~L~V   79 (149)
                      .|||||||+  ..++++|+|||||||++|. |||++||||||+|++.|.++.+|   ++.+|+.++|||+||+.+++|+|
T Consensus       124 ~gg~LGL~n~~~~~~~n~~vAVEFDT~~N~e~Dp~~nHVGIDvNSi~S~~t~~~---~l~~G~~~~vwI~Yd~~tk~L~V  200 (281)
T 3ujo_A          124 KGGFLGLFDSKNYASSNQTVAVEFDTFYNGGWDPTERHIGIDVNSIKSIKTTSW---DFANGENAEVLITYDSSTNLLVA  200 (281)
T ss_dssp             CGGGTTTCSCSSCCTTSCCEEEEECCSCCCSSCCSSSEEEEEESSSCCSCEEEC---CCCSSCCEEEEEEECTTTCEEEE
T ss_pred             CcceeeeccccCCCccCcEEEEEEeccccccCCCCCCeEEEEcCCCCccccccc---cccCCCEEEEEEEEeCCCCEEEE
Confidence            489999998  3368899999999999995 99999999999999999999998   57799999999999999999999


Q ss_pred             EEEcCCCCCcccceeEEEecCCcCCCCceEEEEEeecCC---CcceeEEEEEEEEeCCCCCC
Q 032012           80 AFTGFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRV---DFVIFSIYSWEFNSSLEMDD  138 (149)
Q Consensus        80 ~l~~~~~~~p~~p~Ls~~vdLs~~L~~~v~vGFSasTG~---~~~~h~I~sWsF~s~~~~~~  138 (149)
                      +|.+.+.  ++.|+|++.|||+++|+|+|||||||+||.   ..|.|+|++|+|+++++..+
T Consensus       201 ~l~~~~~--~~~~~lS~~vDL~~~L~e~v~VGFSAsTG~~~~~~e~H~IlsWSFss~l~~~~  260 (281)
T 3ujo_A          201 SLVHPSQ--KTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINK  260 (281)
T ss_dssp             EEECTTT--CCCEEEEEECCSTTTSCSEEEEEEEEEECSSTTSCCCCEEEEEEEEEEECSSS
T ss_pred             EEecCCC--CCCceEEEEechHHhccCcEEEEEEeecCCCCcccceeEEEEEEEEEEcCCCC
Confidence            9998764  457899999999999999999999999996   58999999999999987653



>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Back     alignment and structure
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Back     alignment and structure
>2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Back     alignment and structure
>2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Back     alignment and structure
>2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 149
d1v6ia_232 b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog 2e-12
d2d3sa1237 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso 3e-12
d1f9ka_234 b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca 8e-12
d1hqla_236 b.29.1.1 (A:) Legume lectin {Griffonia simplicifol 2e-11
d1g9fa_251 b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) 5e-11
g1qmo.1230 b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich 1e-10
d1qnwa_237 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 2e-10
d1n47a_233 b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi 2e-10
d1nlsa_ 237 b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia 5e-10
d1gzca_239 b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( 7e-10
d1avba_226 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 9e-10
d1leda_243 b.29.1.1 (A:) Legume lectin {West-central african 2e-09
g2ltn.1229 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum 2e-09
d1g8wa_233 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 4e-09
d1ukga_241 b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero 4e-09
d1g7ya_253 b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos 5e-09
d1fx5a_240 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 9e-09
d1dhkb_204 b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar 2e-08
d1ioaa_228 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 2e-08
d1dbna_239 b.29.1.1 (A:) Legume lectin {Maackia amurensis, le 3e-08
d1fnya_237 b.29.1.1 (A:) Legume lectin {Black locust (Robinia 7e-08
d1gv9a_228 b.29.1.13 (A:) Carbohydrate-recognition domain of 0.001
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Legume lectin
species: Peanut (Arachis hypogaea) [TaxId: 3818]
 Score = 60.2 bits (145), Expect = 2e-12
 Identities = 36/134 (26%), Positives = 48/134 (35%), Gaps = 5/134 (3%)

Query: 3   FSSYLSKFPLYLPRPHGSRFESDVYVNSWDPTISKLLVSISTLCNQRKMYLLRSDVKSGR 62
                          H    E D Y NS         V I    +   +  +  +  SG 
Sbjct: 101 IGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDV-NSVDSVKTVPWNSVSGA 159

Query: 63  RNEAWISYNSSTHNPSVAFTGFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVDFV- 121
             +  + Y+SST   SVA T    +      +   VDL+  LPE V FGFS    +    
Sbjct: 160 VVKVTVIYDSSTKTLSVAVTNDNGDITT---IAQVVDLKAKLPERVKFGFSASGSLGGRQ 216

Query: 122 IFSIYSWEFNSSLE 135
           I  I SW F S+L 
Sbjct: 217 IHLIRSWSFTSTLI 230


>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 Back     information, alignment and structure
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
d1hqla_236 Legume lectin {Griffonia simplicifolia, lectin I-b 100.0
d1leda_243 Legume lectin {West-central african legume (Griffo 100.0
d1fx5a_240 Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI 100.0
d2d3sa1237 Legume lectin {Winged bean (Psophocarpus tetragono 100.0
d1gzca_239 Legume lectin {Cockspur coral tree (Erythrina cris 100.0
d1g9fa_251 Legume lectin {Soybean (Glycine max) [TaxId: 3847] 100.0
d1qnwa_237 Legume lectin {Furze (Ulex europaeus), UEA-II [Tax 100.0
d1nlsa_ 237 Concanavalin A {Jack bean (Canavalia ensiformis) [ 100.0
d1f9ka_234 Legume lectin {Winged bean (Psophocarpus tetragono 100.0
d1g7ya_253 Legume lectin {Horse gram (Dolichos biflorus), dif 100.0
d1n47a_233 Legume lectin {Hairy vetch (Vicia villosa), isolec 100.0
d1g8wa_233 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d1ukga_241 Legume lectin {Bloodwood tree (Pterocarpus angolen 100.0
d1fnya_237 Legume lectin {Black locust (Robinia pseudoacacia) 100.0
g1qmo.1230 Legume lectin {Field bean (Dolichos lablab), Fril 100.0
d1dbna_239 Legume lectin {Maackia amurensis, leukoagglutinin 100.0
d1v6ia_232 Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 100.0
g2ltn.1229 Legume lectin {Garden pea (Pisum sativum) [TaxId: 100.0
d1ioaa_228 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.98
d1avba_226 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.97
d1dhkb_204 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.95
d1gv9a_228 Carbohydrate-recognition domain of P58/ERGIC-53 {R 99.73
d2a6va1218 Emp46p N-terminal domain {Baker's yeast (Saccharom 99.25
d2a6za1221 Emp47p N-terminal domain {Baker's yeast (Saccharom 99.04
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Legume lectin
species: Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]
Probab=100.00  E-value=6.6e-41  Score=266.36  Aligned_cols=129  Identities=28%  Similarity=0.359  Sum_probs=116.4

Q ss_pred             CCCcccCCCC----CCCCCCEEEEEEeCccCC--CCCCCCceeeecCcccccccccccccccCCCceeEEEEEEeCCCCc
Q 032012            3 FSSYLSKFPL----YLPRPHGSRFESDVYVNS--WDPTISKLLVSISTLCNQRKMYLLRSDVKSGRRNEAWISYNSSTHN   76 (149)
Q Consensus         3 ~~~yLGl~~~----~~~~~~~vAVEFDT~~n~--~Dp~~nHVgIdins~~S~~~~~~~~~~l~~G~~~~awI~Yd~~~~~   76 (149)
                      .|+||||++.    +...++.|||||||++|.  +||++||||||+|++.|.++.++...++.+|+.++|||+||+.+++
T Consensus       101 ~G~~lGl~~~~~~~~~~~~~~vAVEFDT~~n~~~~D~~~nHIgIdvns~~s~~~~~~~~~~l~~G~~~~v~I~Yd~~~~~  180 (236)
T d1hqla_         101 AGEYLGLFNKSTATQPSKNQVVAVEFDTWTNPNFPEPSYRHIGINVNSIVSVATKRWEDSDIFSGKIATARISYDGSAEI  180 (236)
T ss_dssp             CGGGTTTSCTTTTTCGGGCCCEEEEEECSCCSSSCCCSSCEEEEEESSSSCSEEEECCHHHHTSCSCEEEEEEEETTTTE
T ss_pred             CccccccccccccCCcccCceEEEEeeCccCCCCCCCCCCEEEEEcCCcccccccccccccccCCCEEEEEEEEeCCCcE
Confidence            4899999993    235689999999999998  5999999999999999999888866789999999999999999999


Q ss_pred             eEEEEEcCCCCCcccceeEEEecCCcCCCCceEEEEEeecCCC-cceeEEEEEEEEeCC
Q 032012           77 PSVAFTGFRNNSVVMQGLGYQVDLRQHLPEFVTFGFSMETRVD-FVIFSIYSWEFNSSL  134 (149)
Q Consensus        77 L~V~l~~~~~~~p~~p~Ls~~vdLs~~L~~~v~vGFSasTG~~-~~~h~I~sWsF~s~~  134 (149)
                      |+|+|.+..   +..|+|++.|||+++|+++|||||||+||.. .+.|+|++|+|++++
T Consensus       181 L~V~l~~~~---~~~~~ls~~vdL~~~l~~~v~vGFSasTG~~~~~~h~I~sWsF~s~l  236 (236)
T d1hqla_         181 LTVVLSYPD---GSDYILSHSVDMRQNLPESVRVGISASTGNNQFLTVYILSWRFSSNL  236 (236)
T ss_dssp             EEEEEEETT---TEEEEEEEECCGGGTSCSEEEEEEEEECCSCCCEEEEEEEEEEEEEC
T ss_pred             EEEEEecCC---CCCeeEEEEeCHHHhCCCcEEEEEEeECCCCCceEEEEEEeEeEecC
Confidence            999998753   5678999999999999999999999999975 677999999999875



>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure