Citrus Sinensis ID: 032034

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MVLKSFHSSFSVFSLYNNIHHPSKLAVGADFYCFKNKIEPKWEDPVCANGGKWTVIFPKGKSDTSWLYTLLAMIGEQFDHGDEICGAVVNVRARQEKISLWTKNASNEAAQMSIGKQWKELLDYSDTIGFIFHEDAKHDNRSKNRYTT
cEEEECccHHHHHHHHcccccccccccccCEEEEEccccccccccccccccEEEEEEccccccHHHHHHHHHHHcccccccccEEEEEEEEcccccEEEEEccccccHHHHHHHHHHHHHHccccccEEEEEcccccccccccccEEc
MVLKSFHSSFSVFSLYNNIHHPSKLAVGADFYCFKNKIEPKWEDPVCANGGKWTVIFPKGKSDTSWLYTLLAMIGEQFDHGDEICGAVVNVRARQEKISLWTKNASNEAAQMSIGKQWKELLDYSDTIGFIFH***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLKSFHSSFSVFSLYNNIHHPSKLAVGADFYCFKNKIEPKWEDPVCANGGKWTVIFPKGKSDTSWLYTLLAMIGEQFDHGDEICGAVVNVRARQEKISLWTKNASNEAAQMSIGKQWKELLDYSDTIGFIFHEDAKHDNRSKNRYTT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 4E-1 Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.probableO23252
Eukaryotic translation initiation factor 4E-1 Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.probableP48599
Eukaryotic translation initiation factor 4E-1 Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.probableO81481

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IDR, chain A
Confidence level:very confident
Coverage over the Query: 2-148
View the alignment between query and template
View the model in PyMOL