Citrus Sinensis ID: 032112


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MMDPSDKGFESDEVNSSGSKRLDGVSSDENSIKKTCADCGTTKTPLWRGGPAGPKSLCNACGIRSRKKRRAILGITKEEKKSKRGNSNSSSNSSSNKLGDSLKQRLYALGREVLMQRSSVEKQRKTLGEEEQAAVLLMALSYGSVYA
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccHHHHcccccHHHHcccccccccccccccccccHHHHHHHcccHHHHHcccHHHHccccccHHHHHHHHHHHHHHccccc
***********************************CADCGTTKTPLWRGGPAGPKSLCNACGIRS********************************************************************AVLLMALSYGSVYA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMDPSDKGFESDEVNSSGSKRLDGVSSDENSIKKTCADCGTTKTPLWRGGPAGPKSLCNACGIRSRKKRRAILGITKEEKKSKRGNSNSSSNSSSNKLGDSLKQRLYALGREVLMQRSSVEKQRKTLGEEEQAAVLLMALSYGSVYA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GATA transcription factor 15 Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.probableQ8LG10

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GAT, chain A
Confidence level:very confident
Coverage over the Query: 30-85
View the alignment between query and template
View the model in PyMOL
Template: 4HC9, chain A
Confidence level:confident
Coverage over the Query: 34-124
View the alignment between query and template
View the model in PyMOL