Citrus Sinensis ID: 032119

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------

MRPPRGGGGFRGGRDGGRGGRGGGRFGGGGRGGGGRGGFGFRDEGPPAEVVEVSSFLHACEGDAVTKLTNEKIPYFNAPIYLQNKTQIGKVDEIFGPINESYFSVKMMEGIVATSYSLGDKFYIDPSKLLPLARFLPQPKCSVSHWY

ccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEECcccEEEEEcccccccccccEEEcccccCEEEEEEcccccccEEEEEEcccccccccccccEEEEccccccccccccccccccccccc

************************************************EVVEVSSFLHACEGDAVTKLTNEKIPYFNAPIYLQNKTQIGKVDEIFGPINESYFSVKMMEGIVATSYSLGDKFYIDPSKLLPLARFLPQP********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MRPPRGGGGFRGGRDGGRGGRGGGRFGGGGRGGGGRGGFGFRDEGPPAEVVEVSSFLHACEGDAVTKLTNEKIPYFNAPIYLQNKTQIGKVDEIFGPINESYFSVKMMEGIVATSYSLGDKFYIDPSKLLPLARFLPQPKCSVSHWY

Annotation	Function Description	Confidence Level	Reference Protein
Putative H/ACA ribonucleoprotein complex subunit 1-like protein 1	Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine ("psi") residues may serve to stabilize the conformation of rRNAs.	probable	Q8VZT0

No EC number assigned to the protein, probably not an enzyme!

Template: 3U28, chain C
Confidence level:very confident
Coverage over the Query: 46-137
View the alignment between query and template
View the model in PyMOL