Citrus Sinensis ID: 032162

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------

MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQSLVS

cHHHHHccccCEEEEccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccEEEEEccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHcccEEECccccHHHHHHHHccccccccHHHHHHHHHHcccccc

MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQS***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQSLVS

Annotation	Function Description	Confidence Level	Reference Protein
Aldo-keto reductase family 4 member C9	Oxidoreductase acting on a broad range of substrates: reduces ketosteroids, aromatic aldehydes, ketones, sugars and other aliphatic aldehydes, and oxidizes hydroxysteroids. May function as detoxifiying enzyme by reducing a range of toxic aldehydes and ketones produced during stress.	probable	Q0PGJ6

No confident prediction of EC number!

Template: 3H7U, chain A
Confidence level:very confident
Coverage over the Query: 1-143
View the alignment between query and template
View the model in PyMOL