Citrus Sinensis ID: 032162

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQSLVS
cHHHHHccccEEEEEccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHcccEEEEccccHHHHHHHHccccccccHHHHHHHHHHHccccc
HHHHHHcccEccEEEEcccHHHHHHHHccccccccEEEEEcEccEccHHHHHHHHHHccEEEEEccccccccccccccccccHHHHHHHcccHHHHHHHHHHHcccEEEcccccHHHHHHHHccccccccHHHHHHHccccccccc
mealydsgkaraigvsNFSLKKLgdlleiarippavnqvechpawqQTKLQAFCKskgvhlsgysplgsaknthrvlqnpIVNTVAEKLGKSPAQVALRWGLqmghsvlpksanearlkenfdifdwyipedllakfpeieqslvs
mealydsgkaraigvsnFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPeieqslvs
MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQSLVS
**********RAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFP********
MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQS***
********KARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQSLVS
MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQ****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQSLVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query146 2.2.26 [Sep-21-2011]
Q0PGJ6315 Aldo-keto reductase famil yes no 0.979 0.453 0.787 1e-63
Q84TF0314 Aldo-keto reductase famil no no 0.972 0.452 0.737 2e-58
O80944311 Aldo-keto reductase famil no no 0.972 0.456 0.744 2e-57
Q9M338315 Aldo-keto reductase famil no no 0.979 0.453 0.678 5e-56
P23901320 Aldose reductase OS=Horde N/A no 0.890 0.406 0.469 1e-31
Q9SQ64321 Non-functional NADPH-depe N/A no 0.993 0.451 0.473 3e-30
Q7G765322 Probable NAD(P)H-dependen no no 0.945 0.428 0.479 3e-30
P26690315 NAD(P)H-dependent 6'-deox no no 0.979 0.453 0.448 5e-30
Q7G764321 Probable NAD(P)H-dependen no no 0.965 0.439 0.458 4e-29
Q4DJ07283 Prostaglandin F synthase N/A no 0.972 0.501 0.412 4e-29
>sp|Q0PGJ6|AKRC9_ARATH Aldo-keto reductase family 4 member C9 OS=Arabidopsis thaliana GN=AKR4C9 PE=1 SV=1 Back     alignment and function desciption
 Score =  241 bits (614), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 115/146 (78%), Positives = 127/146 (86%), Gaps = 3/146 (2%)

Query: 1   MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVH 60
           MEALYDSGKARAIGVSNFS KKL DLLE+AR+PPAVNQVECHP+W+QTKLQ FCKSKGVH
Sbjct: 143 MEALYDSGKARAIGVSNFSTKKLADLLELARVPPAVNQVECHPSWRQTKLQEFCKSKGVH 202

Query: 61  LSGYSPLGSAKNT---HRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEAR 117
           LS YSPLGS   T     VL+NPI+N VAEKLGKSPAQVALRWGLQMGHSVLPKS NE R
Sbjct: 203 LSAYSPLGSPGTTWLKSDVLKNPILNMVAEKLGKSPAQVALRWGLQMGHSVLPKSTNEGR 262

Query: 118 LKENFDIFDWYIPEDLLAKFPEIEQS 143
           +KENF++FDW IP+ + AKF EIEQ+
Sbjct: 263 IKENFNVFDWSIPDYMFAKFAEIEQA 288
Oxidoreductase acting on a broad range of substrates: reduces ketosteroids, aromatic aldehydes, ketones, sugars and other aliphatic aldehydes, and oxidizes hydroxysteroids. May function as detoxifiying enzyme by reducing a range of toxic aldehydes and ketones produced during stress.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q84TF0|AKRCA_ARATH Aldo-keto reductase family 4 member C10 OS=Arabidopsis thaliana GN=AKR4C10 PE=1 SV=1 Back     alignment and function description
>sp|O80944|AKRC8_ARATH Aldo-keto reductase family 4 member C8 OS=Arabidopsis thaliana GN=AKR4C8 PE=1 SV=2 Back     alignment and function description
>sp|Q9M338|AKRCB_ARATH Aldo-keto reductase family 4 member C11 OS=Arabidopsis thaliana GN=AKR4C11 PE=2 SV=1 Back     alignment and function description
>sp|P23901|ALDR_HORVU Aldose reductase OS=Hordeum vulgare PE=1 SV=1 Back     alignment and function description
>sp|Q9SQ64|COR2_PAPSO Non-functional NADPH-dependent codeinone reductase 2 OS=Papaver somniferum GN=COR2 PE=1 SV=1 Back     alignment and function description
>sp|Q7G765|NADO2_ORYSJ Probable NAD(P)H-dependent oxidoreductase 2 OS=Oryza sativa subsp. japonica GN=Os10g0113100 PE=2 SV=1 Back     alignment and function description
>sp|P26690|6DCS_SOYBN NAD(P)H-dependent 6'-deoxychalcone synthase OS=Glycine max PE=1 SV=1 Back     alignment and function description
>sp|Q7G764|NADO1_ORYSJ Probable NAD(P)H-dependent oxidoreductase 1 OS=Oryza sativa subsp. japonica GN=Os10g0113000 PE=1 SV=1 Back     alignment and function description
>sp|Q4DJ07|PGFS_TRYCC Prostaglandin F synthase OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053511287.49 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
388520373 315 unknown [Lotus japonicus] 0.979 0.453 0.787 9e-62
79324628 315 NAD(P)-linked oxidoreductase-like protei 0.979 0.453 0.787 1e-61
255311879 335 Chain A, Crystal Structure Of The Plant 0.979 0.426 0.787 1e-61
297823651 315 oxidoreductase [Arabidopsis lyrata subsp 0.979 0.453 0.780 1e-61
3236259 290 putative alcohol dehydrogenase [Arabidop 0.972 0.489 0.793 1e-61
28393400 304 putative aldo/keto reductase [Arabidopsi 0.979 0.470 0.787 1e-61
356496078 315 PREDICTED: aldo-keto reductase family 4 0.979 0.453 0.780 2e-61
255577997 315 aldo-keto reductase, putative [Ricinus c 0.979 0.453 0.773 3e-61
297740315 368 unnamed protein product [Vitis vinifera] 1.0 0.396 0.733 4e-61
225440476 313 PREDICTED: aldo-keto reductase family 4 0.972 0.453 0.753 1e-60
>gi|388520373|gb|AFK48248.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
 Score =  241 bits (614), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 115/146 (78%), Positives = 128/146 (87%), Gaps = 3/146 (2%)

Query: 1   MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVH 60
           MEALYDSGKARAIGVSNFS KKLGDLLE+ARIPPA NQVECHP+WQQ KL+ FCKSKGVH
Sbjct: 143 MEALYDSGKARAIGVSNFSSKKLGDLLEVARIPPAANQVECHPSWQQDKLRDFCKSKGVH 202

Query: 61  LSGYSPLGSAKNT---HRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEAR 117
           LSGYSPLGS   T     VL +P++N +AEKLGK+PAQVALRWGLQ G+SVLPKS NEAR
Sbjct: 203 LSGYSPLGSPGTTWLKSDVLNHPVINVIAEKLGKTPAQVALRWGLQKGNSVLPKSTNEAR 262

Query: 118 LKENFDIFDWYIPEDLLAKFPEIEQS 143
           +K+NFD+FDW IPEDLLAKF EIEQ+
Sbjct: 263 IKQNFDVFDWTIPEDLLAKFSEIEQA 288

Source: Lotus japonicus

Species: Lotus japonicus

Genus: Lotus

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|79324628|ref|NP_001031505.1| NAD(P)-linked oxidoreductase-like protein [Arabidopsis thaliana] gi|122241485|sp|Q0PGJ6.1|AKRC9_ARATH RecName: Full=Aldo-keto reductase family 4 member C9 gi|111182165|gb|ABH07515.1| aldo-keto reductase [Arabidopsis thaliana] gi|330254355|gb|AEC09449.1| NAD(P)-linked oxidoreductase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255311879|pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Back     alignment and taxonomy information
>gi|297823651|ref|XP_002879708.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297325547|gb|EFH55967.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|3236259|gb|AAC23647.1| putative alcohol dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|28393400|gb|AAO42123.1| putative aldo/keto reductase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356496078|ref|XP_003516897.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Glycine max] Back     alignment and taxonomy information
>gi|255577997|ref|XP_002529870.1| aldo-keto reductase, putative [Ricinus communis] gi|223530646|gb|EEF32520.1| aldo-keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297740315|emb|CBI30497.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225440476|ref|XP_002272736.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
TAIR|locus:2040646315 ChlAKR "Chloroplastic aldo-ket 0.979 0.453 0.787 1.9e-58
TAIR|locus:2065639314 AKR4C10 "Aldo-keto reductase f 0.972 0.452 0.737 8.9e-54
TAIR|locus:2040751311 AKR4C8 "Aldo-keto reductase fa 0.972 0.456 0.758 8e-53
TAIR|locus:2084505315 AKR4C11 "Aldo-keto reductase f 0.979 0.453 0.678 5.6e-52
TAIR|locus:2025926320 AT1G59950 [Arabidopsis thalian 0.993 0.453 0.463 3e-30
UNIPROTKB|Q9SQ64321 COR2 "Non-functional NADPH-dep 0.986 0.448 0.490 4.9e-30
TAIR|locus:2149715349 AT5G01670 [Arabidopsis thalian 0.897 0.375 0.458 1.3e-29
TAIR|locus:2154164316 AT5G62420 [Arabidopsis thalian 0.972 0.449 0.448 7.1e-29
ASPGD|ASPL0000011447297 AN11030 [Emericella nidulans ( 0.815 0.400 0.495 3.5e-27
UNIPROTKB|Q2TJA5322 AKR1C4 "Aldo-keto reductase" [ 0.986 0.447 0.444 4.5e-27
TAIR|locus:2040646 ChlAKR "Chloroplastic aldo-keto reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 600 (216.3 bits), Expect = 1.9e-58, P = 1.9e-58
 Identities = 115/146 (78%), Positives = 127/146 (86%)

Query:     1 MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVH 60
             MEALYDSGKARAIGVSNFS KKL DLLE+AR+PPAVNQVECHP+W+QTKLQ FCKSKGVH
Sbjct:   143 MEALYDSGKARAIGVSNFSTKKLADLLELARVPPAVNQVECHPSWRQTKLQEFCKSKGVH 202

Query:    61 LSGYSPLGSAKNT---HRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEAR 117
             LS YSPLGS   T     VL+NPI+N VAEKLGKSPAQVALRWGLQMGHSVLPKS NE R
Sbjct:   203 LSAYSPLGSPGTTWLKSDVLKNPILNMVAEKLGKSPAQVALRWGLQMGHSVLPKSTNEGR 262

Query:   118 LKENFDIFDWYIPEDLLAKFPEIEQS 143
             +KENF++FDW IP+ + AKF EIEQ+
Sbjct:   263 IKENFNVFDWSIPDYMFAKFAEIEQA 288
GO:0005737 "cytoplasm" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA;IDA
GO:0004033 "aldo-keto reductase (NADP) activity" evidence=IDA
GO:0009409 "response to cold" evidence=IEP
GO:0009414 "response to water deprivation" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP
GO:0016229 "steroid dehydrogenase activity" evidence=IDA
GO:0070401 "NADP+ binding" evidence=IDA
GO:0008106 "alcohol dehydrogenase (NADP+) activity" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2065639 AKR4C10 "Aldo-keto reductase family 4 member C10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040751 AKR4C8 "Aldo-keto reductase family 4 member C8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084505 AKR4C11 "Aldo-keto reductase family 4 member C11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025926 AT1G59950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SQ64 COR2 "Non-functional NADPH-dependent codeinone reductase 2" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
TAIR|locus:2149715 AT5G01670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154164 AT5G62420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000011447 AN11030 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TJA5 AKR1C4 "Aldo-keto reductase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0PGJ6AKRC9_ARATH1, ., 1, ., 1, ., -0.78760.97940.4539yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT2G37770
aldo/keto reductase family protein; aldo/keto reductase family protein; FUNCTIONS IN- oxidoreductase activity; INVOLVED IN- oxidation reduction; EXPRESSED IN- 12 plant structures; EXPRESSED DURING- 4 anthesis, LP.04 four leaves visible, petal differentiation and expansion stage; CONTAINS InterPro DOMAIN/s- Aldo/keto reductase (InterPro-IPR001395), Aldo/keto reductase, conserved site (InterPro-IPR018170); BEST Arabidopsis thaliana protein match is- aldo/keto reductase family protein (TAIR-AT2G37790.1); Has 14424 Blast hits to 14398 proteins in 1391 species- Archae - 167; Bacteria - 7993 [...] (315 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT3G04000
short-chain dehydrogenase/reductase (SDR) family protein; short-chain dehydrogenase/reductase ( [...] (272 aa)
   •  • 0.798
AT2G37760
aldo/keto reductase family protein; aldo/keto reductase family protein; FUNCTIONS IN- oxidoredu [...] (311 aa)
  ••  ••0.757
AT5G39050
transferase/ transferase, transferring acyl groups other than amino-acyl groups; transferase/ t [...] (469 aa)
   •  • 0.667
AT2G24190
short-chain dehydrogenase/reductase (SDR) family protein; short-chain dehydrogenase/reductase ( [...] (301 aa)
      • 0.629
ELI3-2
ELI3-2 (ELICITOR-ACTIVATED GENE 3-2); aryl-alcohol dehydrogenase/ mannitol dehydrogenase; Encod [...] (359 aa)
   •    0.587
RD20
RD20 (RESPONSIVE TO DESSICATION 20); calcium ion binding; Encodes a calcium binding protein who [...] (236 aa)
   •    0.581
UGT84A3
UGT84A3; UDP-glycosyltransferase/ sinapate 1-glucosyltransferase/ transferase, transferring gly [...] (479 aa)
   •    0.573
AT5G61510
NADP-dependent oxidoreductase, putative; NADP-dependent oxidoreductase, putative; FUNCTIONS IN- [...] (406 aa)
   •  • 0.556
BGLU11
BGLU11 (BETA GLUCOSIDASE 11); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl com [...] (521 aa)
   •    0.554
AT1G09500
cinnamyl-alcohol dehydrogenase family / CAD family; similar to Eucalyptus gunnii alcohol dehydr [...] (325 aa)
   •    0.553

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 5e-57
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 1e-46
pfam00248277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 4e-31
PRK11565275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 6e-31
PRK11172267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 3e-26
COG0667316 COG0667, Tas, Predicted oxidoreductases (related t 1e-15
COG4989298 COG4989, COG4989, Predicted oxidoreductase [Genera 3e-07
PRK10376290 PRK10376, PRK10376, putative oxidoreductase; Provi 8e-06
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information 
 Score =  178 bits (454), Expect = 5e-57
 Identities = 61/136 (44%), Positives = 89/136 (65%), Gaps = 3/136 (2%)

Query: 1   MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVH 60
           +E L D G  RAIGVSNF ++ L +LL +A++ PAVNQ+E HP  +Q +L  FC+  G+ 
Sbjct: 126 LEELVDEGLIRAIGVSNFGVEHLEELLSLAKVKPAVNQIEYHPYLRQPELLPFCQRHGIA 185

Query: 61  LSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKE 120
           +  YSPL       ++L NP++  +A+K GK+PAQVALRW +Q G  V+PKS    R++E
Sbjct: 186 VEAYSPLAKGG---KLLDNPVLAEIAKKYGKTPAQVALRWHIQRGVIVIPKSTTPERIRE 242

Query: 121 NFDIFDWYIPEDLLAK 136
           N   FD+ + E+ +A 
Sbjct: 243 NLAAFDFELSEEDMAA 258

Length = 280
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 146
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
KOG1577300 consensus Aldo/keto reductase family proteins [Gen 100.0
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 100.0
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 100.0
KOG1575336 consensus Voltage-gated shaker-like K+ channel, su 100.0
PRK10376290 putative oxidoreductase; Provisional 99.98
PRK09912346 L-glyceraldehyde 3-phosphate reductase; Provisiona 99.97
COG0667316 Tas Predicted oxidoreductases (related to aryl-alc 99.97
TIGR01293317 Kv_beta voltage-dependent potassium channel beta s 99.97
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 99.97
PRK10625346 tas putative aldo-keto reductase; Provisional 99.97
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 99.97
COG4989298 Predicted oxidoreductase [General function predict 99.96
PLN02587314 L-galactose dehydrogenase 99.96
PRK14863292 bifunctional regulator KidO; Provisional 99.96
COG1453 391 Predicted oxidoreductases of the aldo/keto reducta 99.92
KOG1576342 consensus Predicted oxidoreductase [Energy product 99.75
KOG3023285 consensus Glutamate-cysteine ligase regulatory sub 98.7
PRK10558 256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 93.83
PRK10128 267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 93.14
TIGR03239 249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 92.77
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 91.42
TIGR00216280 ispH_lytB (E)-4-hydroxy-3-methyl-but-2-enyl pyroph 90.46
PRK12360281 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 89.71
PRK01045298 ispH 4-hydroxy-3-methylbut-2-enyl diphosphate redu 89.63
COG1140 513 NarY Nitrate reductase beta subunit [Energy produc 88.91
COG0761294 lytB 4-Hydroxy-3-methylbut-2-enyl diphosphate redu 87.54
TIGR02311 249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 87.44
PF02401281 LYTB: LytB protein; InterPro: IPR003451 Terpenes a 86.84
COG4130272 Predicted sugar epimerase [Carbohydrate transport 86.32
PRK00087 647 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 82.24
COG1149284 MinD superfamily P-loop ATPase containing an inser 81.06
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=6.4e-40  Score=241.66  Aligned_cols=141  Identities=43%  Similarity=0.806  Sum_probs=135.1

Q ss_pred             CHhHHHcCCccEEEeCCCCHHHHHHHHHhCCCCceEEecccCccCCcHHHHHHHHHcCceEEEeccCCCCCCCCCCCCcH
Q 032162            1 MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNP   80 (146)
Q Consensus         1 l~~l~~~G~ir~iGvS~~~~~~l~~~~~~~~~~~~~~q~~~~~~~~~~~~~~~~~~~gi~~~~~~~l~~gg~~~~~~~~~   80 (146)
                      |++++++||||+||||||++++++++++.+++.|++||++||++.+++++++||+++||.+++|+||+.|+   .+++++
T Consensus       126 lE~l~~~G~ir~IGVSNF~~~~L~~l~~~~~~~p~~NQIe~hp~~~q~el~~~~~~~gI~v~AysPL~~g~---~l~~~~  202 (280)
T COG0656         126 LEELVDEGLIRAIGVSNFGVEHLEELLSLAKVKPAVNQIEYHPYLRQPELLPFCQRHGIAVEAYSPLAKGG---KLLDNP  202 (280)
T ss_pred             HHHHHhcCCccEEEeeCCCHHHHHHHHHhcCCCCceEEEEeccCCCcHHHHHHHHHcCCEEEEECCccccc---ccccCh
Confidence            68999999999999999999999999999999999999999999999999999999999999999999763   389999


Q ss_pred             HHHHHHHHhCCCHHHHHHHhhhcCCcEEeecCCCHHHHHHhhcccCccCCHHHHHhhHhhhhhh
Q 032162           81 IVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQSL  144 (146)
Q Consensus        81 ~l~~~a~~~~~s~~~lal~~~l~~~~~~i~g~~~~~~l~~n~~a~~~~L~~~~~~~l~~~~~~~  144 (146)
                      .+.++|++||.|++|++|||.+++|+++||.+++++|+++|++++++.||+|||+.|+.+....
T Consensus       203 ~l~~Ia~k~g~t~AQv~L~W~i~~gv~~Ipks~~~~ri~eN~~~~~f~Ls~ed~~~i~~l~~~~  266 (280)
T COG0656         203 VLAEIAKKYGKTPAQVALRWHIQRGVIVIPKSTTPERIRENLAAFDFELSEEDMAAIDALDRGY  266 (280)
T ss_pred             HHHHHHHHhCCCHHHHHHHHHHhCCcEEecCCCCHHHHHHHHhhhcCCCCHHHHHHHHhhcccc
Confidence            9999999999999999999999999999999999999999999999999999999999987654

>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information
>KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR00216 ispH_lytB (E)-4-hydroxy-3-methyl-but-2-enyl pyrophosphate reductase (IPP and DMAPP forming) Back     alignment and domain information
>PRK12360 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK01045 ispH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Reviewed Back     alignment and domain information
>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] Back     alignment and domain information
>COG0761 lytB 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH [Lipid metabolism] Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PF02401 LYTB: LytB protein; InterPro: IPR003451 Terpenes are among the largest groups of natural products and include compounds such as vitamins, cholesterol and carotenoids Back     alignment and domain information
>COG4130 Predicted sugar epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
3h7u_A335 Crystal Structure Of The Plant Stress-Response Enzy 2e-64
3h7r_A331 Crystal Structure Of The Plant Stress-Response Enzy 2e-58
2bgq_A344 Apo Aldose Reductase From Barley Length = 344 9e-33
4fzi_A290 Crystal Structure Of Prostaglandin F Synthase From 3e-30
1zgd_A312 Chalcone Reductase Complexed With Nadp+ At 1.7 Angs 6e-30
3f7j_A276 B.Subtilis Yvgn Length = 276 9e-29
3d3f_A275 Crystal Structure Of Yvgn And Cofactor Nadph From B 1e-28
1ae4_A325 Aldehyde Reductase Complexed With Cofactor And Inhi 4e-28
1cwn_A324 Crystal Structure Of Porcine Aldehyde Reductase Hol 4e-28
1hqt_A326 The Crystal Structure Of An Aldehyde Reductase Y50f 5e-28
3cv7_A325 Crystal Structure Of Porcine Aldehyde Reductase Ter 6e-28
3b3d_A314 B.Subtilis Ytbe Length = 314 2e-27
2alr_A324 Aldehyde Reductase Length = 324 4e-27
4gac_A324 High Resolution Structure Of Mouse Aldehyde Reducta 6e-27
4f40_A288 X-Ray Crystal Structure Of Apo Prostaglandin F Synt 7e-27
1vbj_A281 The Crystal Structure Of Prostaglandin F Synthase F 3e-25
1q5m_A322 Binary Complex Of Rabbit 20alpha-Hydroxysteroid Deh 5e-25
1q13_A323 Crystal Structure Of Rabbit 20alpha Hyroxysteroid D 5e-25
3o0k_A283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 9e-25
1vp5_A298 Crystal Structure Of 2,5-diketo-d-gluconic Acid Red 2e-24
3bur_A326 Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta- 2e-24
3uwe_A331 Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length 3e-24
3uzw_A346 Crystal Structure Of 5beta-Reductase (Akr1d1) E120h 3e-24
3cmf_A346 Crystal Structure Of Human Liver 5beta-Reductase (A 3e-24
1s1p_A331 Crystal Structures Of Prostaglandin D2 11-Ketoreduc 3e-24
3r43_A331 Akr1c3 Complexed With Mefenamic Acid Length = 331 4e-24
1ry0_A323 Structure Of Prostaglandin F Synthase With Prostagl 4e-24
2fvl_A324 Crystal Structure Of Human 3-alpha Hydroxysteroid/d 6e-24
1xjb_A325 Crystal Structure Of Human Type 3 3alpha-Hydroxyste 1e-23
1ihi_A323 Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy 1e-23
3gug_A323 Crystal Structure Of Akr1c1 L308v Mutant In Complex 1e-23
2ipj_A321 Crystal Structure Of H3alpha-Hydroxysteroid Dehydro 1e-23
3c3u_A323 Crystal Structure Of Akr1c1 In Complex With Nadp An 1e-23
1j96_A323 Human 3alpha-Hsd Type 3 In Ternary Complex With Nad 1e-23
1mrq_A323 Crystal Structure Of Human 20alpha-hsd In Ternary C 1e-23
1dla_A314 Novel Nadph-Binding Domain Revealed By The Crystal 3e-23
1eko_A315 Pig Aldose Reductase Complexed With Idd384 Inhibito 3e-23
1ah0_A316 Pig Aldose Reductase Complexed With Sorbinil Length 3e-23
2ipw_A315 Crystal Structure Of C298a W219y Aldose Reductase C 3e-23
1mzr_A296 Structure Of Dkga From E.Coli At 2.13 A Resolution 1e-22
2pdq_A316 Human Aldose Reductase Mutant C303d Complexed With 1e-22
2pdk_A316 Human Aldose Reductase Mutant L301m Complexed With 1e-22
3q67_A316 Human Aldose Reductase C298s Mutant In Complex With 1e-22
1abn_A315 The Crystal Structure Of The Aldose Reductase Nadph 1e-22
1pwl_A316 Crystal Structure Of Human Aldose Reductase Complex 1e-22
2pdx_A316 Human Aldose Reductase Double Mutant S302r-C303d Co 1e-22
1el3_A316 Human Aldose Reductase Complexed With Idd384 Inhibi 1e-22
3lz5_A316 Human Aldose Reductase Mutant T113v Complexed With 1e-22
2pdf_A316 Human Aldose Reductase Mutant L300p Complexed With 1e-22
2pd5_A316 Human Aldose Reductase Mutant V47i Complexed With Z 1e-22
3lqg_A316 Human Aldose Reductase Mutant T113a Complexed With 1e-22
3ld5_A316 Human Aldose Reductase Mutant T113s Complexed With 1e-22
2pdm_A316 Human Aldose Reductase Mutant S302r Complexed With 1e-22
2pdi_A316 Human Aldose Reductase Mutant L300a Complexed With 1e-22
2r24_A316 Human Aldose Reductase Structure Length = 316 1e-22
2pdb_A316 Human Aldose Reductase Mutant F121p Complexed With 1e-22
3lbo_A316 Human Aldose Reductase Mutant T113c Complexed With 1e-22
1z3n_A319 Human Aldose Reductase In Complex With Nadp+ And Th 1e-22
3onb_A315 Bond Breakage And Relocation Of A Covalently Bound 1e-22
2acu_A315 Tyrosine-48 Is The Proton Donor And Histidine-110 D 1e-22
1ef3_A315 Fidarestat Bound To Human Aldose Reductase Length = 1e-22
1zua_X317 Crystal Structure Of Akr1b10 Complexed With Nadp+ A 1e-22
2agt_A319 Aldose Reductase Mutant Leu 300 Pro Complexed With 2e-22
2is7_A315 Crystal Structure Of Aldose Reductase Complexed Wit 2e-22
3rx2_A336 Crystal Structure Of Human Aldose Reductase Complex 2e-22
1c9w_A315 Cho Reductase With Nadp+ Length = 315 2e-22
3qkz_A316 Crystal Structure Of Mutant His269arg Akr1b14 Lengt 2e-22
2ipf_A318 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 2e-22
3cv6_A323 The Crystal Structure Of Mouse 17-Alpha Hydroxyster 3e-22
2ipg_A319 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 3e-22
3fjn_A323 The Crystal Structure Of 17-Alpha Hydroxysteroid De 3e-22
2he5_A323 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 3e-22
1frb_A315 Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 3e-22
3o3r_A316 Crystal Structure Of Akr1b14 In Complex With Nadp L 9e-22
1xgd_A315 Apo R268a Human Aldose Reductase Length = 315 1e-21
2wzm_A283 Crystal Structure Of A Mycobacterium Aldo-Keto Redu 3e-21
1qwk_A317 Structural Genomics Of Caenorhabditis Elegans: Hypo 2e-20
1ral_A308 Three-Dimensional Structure Of Rat Liver 3alpha- Hy 3e-20
1r38_A322 Crystal Structure Of H114a Mutant Of Candida Tenuis 4e-20
1z9a_A321 Crystal Structure Of The Asn-309 To Asp Mutant Of C 4e-20
1jez_A322 The Structure Of Xylose Reductase, A Dimeric Aldo-K 4e-20
1afs_A323 Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydr 4e-20
1lwi_A322 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FRO 4e-20
1a80_A277 Native 2,5-Diketo-D-Gluconic Acid Reductase A From 6e-20
1hw6_A278 Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Red 6e-20
1sm9_A322 Crystal Structure Of An Engineered K274rn276d Doubl 7e-20
1ye4_A322 Crystal Structure Of The Lys-274 To Arg Mutant Of C 7e-20
3up8_A298 Crystal Structure Of A Putative 2,5-Diketo-D-Glucon 4e-19
1m9h_A278 Corynebacterium 2,5-dkgr A And Phe 22 Replaced With 2e-18
3krb_A334 Structure Of Aldose Reductase From Giardia Lamblia 2e-17
3ln3_A324 Crystal Structure Of Putative Reductase (Np_038806. 2e-15
>pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 Back     alignment and structure 
Iteration: 1

 Score =  240 bits (613), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 115/146 (78%), Positives = 127/146 (86%), Gaps = 3/146 (2%)
Query: 1   MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVH 60
           MEALYDSGKARAIGVSNFS KKL DLLE+AR+PPAVNQVECHP+W+QTKLQ FCKSKGVH
Sbjct: 163 MEALYDSGKARAIGVSNFSTKKLADLLELARVPPAVNQVECHPSWRQTKLQEFCKSKGVH 222
Query: 61  LSGYSPLGSAKNT---HRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEAR 117
           LS YSPLGS   T     VL+NPI+N VAEKLGKSPAQVALRWGLQMGHSVLPKS NE R
Sbjct: 223 LSAYSPLGSPGTTWLKSDVLKNPILNMVAEKLGKSPAQVALRWGLQMGHSVLPKSTNEGR 282
Query: 118 LKENFDIFDWYIPEDLLAKFPEIEQS 143
           +KENF++FDW IP+ + AKF EIEQ+
Sbjct: 283 IKENFNVFDWSIPDYMFAKFAEIEQA 308
>pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 Back     alignment and structure
>pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 Back     alignment and structure
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure
>pdb|1ZGD|A Chain A, Chalcone Reductase Complexed With Nadp+ At 1.7 Angstrom Resolution Length = 312 Back     alignment and structure
>pdb|3F7J|A Chain A, B.Subtilis Yvgn Length = 276 Back     alignment and structure
>pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Length = 275 Back     alignment and structure
>pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 Back     alignment and structure
>pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 Back     alignment and structure
>pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 Back     alignment and structure
>pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 Back     alignment and structure
>pdb|3B3D|A Chain A, B.Subtilis Ytbe Length = 314 Back     alignment and structure
>pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 Back     alignment and structure
>pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 Back     alignment and structure
>pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure
>pdb|1Q5M|A Chain A, Binary Complex Of Rabbit 20alpha-Hydroxysteroid Dehydrogenase With Nadph Length = 322 Back     alignment and structure
>pdb|1Q13|A Chain A, Crystal Structure Of Rabbit 20alpha Hyroxysteroid Dehydrogenase In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 Back     alignment and structure
>pdb|3BUR|A Chain A, Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta-Reductase In Complex With Nadp And Testosterone. Resolution: 1.62 A. Length = 326 Back     alignment and structure
>pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 Back     alignment and structure
>pdb|3UZW|A Chain A, Crystal Structure Of 5beta-Reductase (Akr1d1) E120h Mutant In Complex With Nadp+ Length = 346 Back     alignment and structure
>pdb|3CMF|A Chain A, Crystal Structure Of Human Liver 5beta-Reductase (Akr1d1) In Complex With Nadp And Cortisone. Resolution 1.90 A. Length = 346 Back     alignment and structure
>pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 Back     alignment and structure
>pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 Back     alignment and structure
>pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 Back     alignment and structure
>pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 Back     alignment and structure
>pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 Back     alignment and structure
>pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 Back     alignment and structure
>pdb|3GUG|A Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|2IPJ|A Chain A, Crystal Structure Of H3alpha-Hydroxysteroid Dehydrogenase Type 3 Mutant Y24a In Complex With Nadp+ And Epi-Testosterone Length = 321 Back     alignment and structure
>pdb|3C3U|A Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 3,5- Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone Length = 323 Back     alignment and structure
>pdb|1DLA|A Chain A, Novel Nadph-Binding Domain Revealed By The Crystal Structure Of Aldose Reductase Length = 314 Back     alignment and structure
>pdb|1EKO|A Chain A, Pig Aldose Reductase Complexed With Idd384 Inhibitor Length = 315 Back     alignment and structure
>pdb|1AH0|A Chain A, Pig Aldose Reductase Complexed With Sorbinil Length = 316 Back     alignment and structure
>pdb|2IPW|A Chain A, Crystal Structure Of C298a W219y Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 Back     alignment and structure
>pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 Back     alignment and structure
>pdb|2PDQ|A Chain A, Human Aldose Reductase Mutant C303d Complexed With Uracil- Type Inhibitor. Length = 316 Back     alignment and structure
>pdb|2PDK|A Chain A, Human Aldose Reductase Mutant L301m Complexed With Sorbinil. Length = 316 Back     alignment and structure
>pdb|3Q67|A Chain A, Human Aldose Reductase C298s Mutant In Complex With Nadp+ In Space Group P212121 Length = 316 Back     alignment and structure
>pdb|1ABN|A Chain A, The Crystal Structure Of The Aldose Reductase Nadph Binary Complex Length = 315 Back     alignment and structure
>pdb|1PWL|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Nadp And Minalrestat Length = 316 Back     alignment and structure
>pdb|2PDX|A Chain A, Human Aldose Reductase Double Mutant S302r-C303d Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|1EL3|A Chain A, Human Aldose Reductase Complexed With Idd384 Inhibitor Length = 316 Back     alignment and structure
>pdb|3LZ5|A Chain A, Human Aldose Reductase Mutant T113v Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|2PDF|A Chain A, Human Aldose Reductase Mutant L300p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|2PD5|A Chain A, Human Aldose Reductase Mutant V47i Complexed With Zopolrestat Length = 316 Back     alignment and structure
>pdb|3LQG|A Chain A, Human Aldose Reductase Mutant T113a Complexed With Idd388 Length = 316 Back     alignment and structure
>pdb|3LD5|A Chain A, Human Aldose Reductase Mutant T113s Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|2PDM|A Chain A, Human Aldose Reductase Mutant S302r Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|2PDI|A Chain A, Human Aldose Reductase Mutant L300a Complexed With Zopolrestat At 1.55 A. Length = 316 Back     alignment and structure
>pdb|2R24|A Chain A, Human Aldose Reductase Structure Length = 316 Back     alignment and structure
>pdb|2PDB|A Chain A, Human Aldose Reductase Mutant F121p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|3LBO|A Chain A, Human Aldose Reductase Mutant T113c Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|1Z3N|A Chain A, Human Aldose Reductase In Complex With Nadp+ And The Inhibitor Lidorestat At 1.04 Angstrom Length = 319 Back     alignment and structure
>pdb|3ONB|A Chain A, Bond Breakage And Relocation Of A Covalently Bound Bromine Of Idd594 In A Complex With Har T113a Mutant After Extensive Radiation Dose Length = 315 Back     alignment and structure
>pdb|2ACU|A Chain A, Tyrosine-48 Is The Proton Donor And Histidine-110 Directs Substrate Stereochemical Selectivity In The Reduction Reaction Of Human Aldose Reductase: Enzyme Kinetics And The Crystal Structure Of The Y48h Mutant Enzyme Length = 315 Back     alignment and structure
>pdb|1EF3|A Chain A, Fidarestat Bound To Human Aldose Reductase Length = 315 Back     alignment and structure
>pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 Back     alignment and structure
>pdb|2AGT|A Chain A, Aldose Reductase Mutant Leu 300 Pro Complexed With Fidarestat Length = 319 Back     alignment and structure
>pdb|2IS7|A Chain A, Crystal Structure Of Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 Back     alignment and structure
>pdb|3RX2|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Sulindac Sulfone Length = 336 Back     alignment and structure
>pdb|1C9W|A Chain A, Cho Reductase With Nadp+ Length = 315 Back     alignment and structure
>pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 Back     alignment and structure
>pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 Back     alignment and structure
>pdb|3CV6|A Chain A, The Crystal Structure Of Mouse 17-Alpha Hydroxysteroid Dehydrogenase Gg225.226pp Mutant In Complex With Inhibitor And Cofactor Nadp+. Length = 323 Back     alignment and structure
>pdb|2IPG|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase Mutant K31a In Complex With Nadp+ And Epi-Testosterone Length = 319 Back     alignment and structure
>pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 Back     alignment and structure
>pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 Back     alignment and structure
>pdb|1FRB|A Chain A, Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 Back     alignment and structure
>pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 Back     alignment and structure
>pdb|1XGD|A Chain A, Apo R268a Human Aldose Reductase Length = 315 Back     alignment and structure
>pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 Back     alignment and structure
>pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 Back     alignment and structure
>pdb|1RAL|A Chain A, Three-Dimensional Structure Of Rat Liver 3alpha- Hydroxysteroid(Slash)dihydrodiol Dehydrogenase: A Member Of The Aldo-Keto Reductase Superfamily Length = 308 Back     alignment and structure
>pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 Back     alignment and structure
>pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 Back     alignment and structure
>pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 Back     alignment and structure
>pdb|1AFS|A Chain A, Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydrogenase (3-Alpha-Hsd) Complexed With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1LWI|A Chain A, 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FROM Rattus Norvegicus Length = 322 Back     alignment and structure
>pdb|1A80|A Chain A, Native 2,5-Diketo-D-Gluconic Acid Reductase A From Corynbacterium Sp. Complexed With Nadph Length = 277 Back     alignment and structure
>pdb|1HW6|A Chain A, Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Reductase Length = 278 Back     alignment and structure
>pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 Back     alignment and structure
>pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 Back     alignment and structure
>pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 Back     alignment and structure
>pdb|1M9H|A Chain A, Corynebacterium 2,5-dkgr A And Phe 22 Replaced With Tyr (f22y), Lys 232 Replaced With Gly (k232g), Arg 238 Replaced With His (r238h)and Ala 272 Replaced With Gly (a272g)in Presence Of Nadh Cofactor Length = 278 Back     alignment and structure
>pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 Back     alignment and structure
>pdb|3LN3|A Chain A, Crystal Structure Of Putative Reductase (Np_038806.2) From Mus Musculus At 1.18 A Resolution Length = 324 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 5e-84
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 1e-83
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 1e-82
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 8e-82
2ao0_A324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 6e-79
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 7e-79
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 4e-78
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 5e-78
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 6e-78
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 4e-77
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 2e-76
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 7e-76
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 8e-76
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 3e-63
4gie_A290 Prostaglandin F synthase; structural genomics, nia 8e-63
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 1e-62
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 2e-62
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 7e-62
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 2e-61
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 3e-61
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 5e-61
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 2e-60
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 3e-60
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 6e-59
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 3e-50
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 9e-16
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 1e-12
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 4e-12
3erp_A353 Putative oxidoreductase; funded by the national in 6e-11
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 6e-11
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 1e-10
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 4e-10
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 5e-10
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 1e-09
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 1e-09
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 2e-08
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 5e-07
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 5e-04
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
 Score =  248 bits (635), Expect = 5e-84
 Identities = 108/145 (74%), Positives = 116/145 (80%), Gaps = 3/145 (2%)

Query: 1   MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVH 60
           MEALYDSGKARAIGVSNFS KKL DLL +AR+ PAVNQVECHP WQQ  L   CKSKGVH
Sbjct: 159 MEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVWQQQGLHELCKSKGVH 218

Query: 61  LSGYSPLGS---AKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEAR 117
           LSGYSPLGS    +   +VLQNPIV  VAEKLGK+ AQVALRWGLQ GHSVLPKS++ AR
Sbjct: 219 LSGYSPLGSQSKGEVRLKVLQNPIVTEVAEKLGKTTAQVALRWGLQTGHSVLPKSSSGAR 278

Query: 118 LKENFDIFDWYIPEDLLAKFPEIEQ 142
           LKEN D+FDW IPEDL  KF  I Q
Sbjct: 279 LKENLDVFDWSIPEDLFTKFSNIPQ 303
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 100.0
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 100.0
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 100.0
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 100.0
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
4gac_A324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 100.0
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 100.0
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
4gie_A290 Prostaglandin F synthase; structural genomics, nia 100.0
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 100.0
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 100.0
3erp_A353 Putative oxidoreductase; funded by the national in 100.0
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 100.0
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 100.0
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 100.0
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 100.0
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 100.0
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 100.0
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 100.0
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 100.0
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 100.0
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 100.0
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 100.0
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 99.97
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 97.26
3dnf_A297 ISPH, LYTB, 4-hydroxy-3-methylbut-2-ENYL diphospha 89.25
3szu_A328 ISPH, 4-hydroxy-3-methylbut-2-ENYL diphosphate red 84.61
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
Probab=100.00  E-value=6.8e-38  Score=232.52  Aligned_cols=139  Identities=45%  Similarity=0.758  Sum_probs=133.1

Q ss_pred             CHhHHHcCCccEEEeCCCCHHHHHHHHHhCCCCceEEecccCccCCcHHHHHHHHHcCceEEEeccCCCCCCCCCCCCcH
Q 032162            1 MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNP   80 (146)
Q Consensus         1 l~~l~~~G~ir~iGvS~~~~~~l~~~~~~~~~~~~~~q~~~~~~~~~~~~~~~~~~~gi~~~~~~~l~~gg~~~~~~~~~   80 (146)
                      |++|+++||||+||||||++++++++.+.+.++|.++|++||++.++.+++++|+++||++++|+||++|    .++.++
T Consensus       126 l~~l~~~Gkir~iGvSn~~~~~l~~~~~~~~~~~~~~Q~~~~~~~~~~~l~~~~~~~gi~v~a~spl~~G----~l~~~~  201 (276)
T 3f7j_A          126 LEKLYKDGKIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPLMQG----QLLDNE  201 (276)
T ss_dssp             HHHHHHTTSEEEEEEESCCHHHHHHHHHHCSSCCSEEEEECBTTBCCHHHHHHHHHHTCEEEEESTTGGG----TTTTCH
T ss_pred             HHHHHHcCCccEEEeccCCHHHHHHHHHhcCCCceeeeeeeccccCCHHHHHHHHHCCCEEEEecCCCCC----ccCCCH
Confidence            5789999999999999999999999999999999999999999999999999999999999999999887    577889


Q ss_pred             HHHHHHHHhCCCHHHHHHHhhhcCCcEEeecCCCHHHHHHhhcccCccCCHHHHHhhHhhhhh
Q 032162           81 IVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQS  143 (146)
Q Consensus        81 ~l~~~a~~~~~s~~~lal~~~l~~~~~~i~g~~~~~~l~~n~~a~~~~L~~~~~~~l~~~~~~  143 (146)
                      .+.++|+++|+|++|+||+|+++++.++|||+++++|+++|+++++++||++|++.|+++.+.
T Consensus       202 ~l~~ia~~~g~t~aqval~w~l~~~~v~i~g~~~~~~l~en~~a~~~~L~~e~~~~l~~l~~~  264 (276)
T 3f7j_A          202 VLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDMDKIDALNKD  264 (276)
T ss_dssp             HHHHHHHHHTCCHHHHHHHHHHHTTCEECCBCCSHHHHHHHTCCSSCCCCHHHHHHHHTTCCC
T ss_pred             HHHHHHHHhCCCHHHHHHHHHHhCCCEEeeCCCCHHHHHHHHhhCCCCCCHHHHHHHHhhccC
Confidence            999999999999999999999999999999999999999999999999999999999998764
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>3dnf_A ISPH, LYTB, 4-hydroxy-3-methylbut-2-ENYL diphosphate reductas; trilobal strucure, open alpha/beta, iron, iron-sulfur, isopr biosynthesis; 1.65A {Aquifex aeolicus} Back     alignment and structure
>3szu_A ISPH, 4-hydroxy-3-methylbut-2-ENYL diphosphate reductas; 3Fe-4S iron-sulfur cluster, conserved cysteine, IPP and DMAP production final STEP; HET: H6P; 1.40A {Escherichia coli} PDB: 3szl_A* 3f7t_A* 3szo_A* 3t0f_A* 3t0g_A* 3urk_A* 3utc_A* 3utd_A* 3uv3_A* 3uv6_A* 3uv7_A* 3uwm_A* 3ke8_A* 3ke9_A* 3kef_A* 3kel_A 3kem_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 146
d1us0a_314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 7e-32
d1s1pa_315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 1e-31
d1hqta_324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 5e-29
d1afsa_319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 1e-28
d1mi3a_319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 2e-28
d1mzra_274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 1e-26
d1frba_315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 5e-25
d1vp5a_284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 8e-25
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 2e-24
d1pyfa_311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 6e-22
d1lqaa_346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 3e-21
d1qwka_312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 2e-18
d3eaua1326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 6e-13
d1pz1a_333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 3e-12
d1ur3m_298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 7e-12
d1gvea_324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 8e-09
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Aldose reductase (aldehyde reductase)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  113 bits (282), Expect = 7e-32
 Identities = 53/144 (36%), Positives = 82/144 (56%), Gaps = 8/144 (5%)

Query: 1   MEALYDSGKARAIGVSNFSLKKLGDLLEIA--RIPPAVNQVECHPAWQQTKLQAFCKSKG 58
           ME L D G  +AIG+SNF+  ++  +L     +  PAVNQ+ECHP   Q KL  +C+SKG
Sbjct: 145 MEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKG 204

Query: 59  VHLSGYSPLG------SAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKS 112
           + ++ YSPLG      +      +L++P +  +A K  K+ AQV +R+ +Q    V+PKS
Sbjct: 205 IVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKS 264

Query: 113 ANEARLKENFDIFDWYIPEDLLAK 136
               R+ ENF +FD+ +    +  
Sbjct: 265 VTPERIAENFKVFDFELSSQDMTT 288
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 324 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
d1hqta_324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 100.0
d1afsa_319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 100.0
d1s1pa_315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 100.0
d1us0a_314 Aldose reductase (aldehyde reductase) {Human (Homo 100.0
d1qwka_312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 100.0
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 100.0
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 100.0
d1mi3a_319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 100.0
d1lqaa_346 Tas protein {Escherichia coli [TaxId: 562]} 100.0
d1frba_315 FR-1 (fibroblast growth factor-induced) protein {M 99.98
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 99.97
d1pyfa_311 Putative oxidoreductase IolS {Bacillus subtilis [T 99.97
d1gvea_324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 99.96
d1pz1a_333 Putative oxidoreductase YhdN {Bacillus subtilis [T 99.96
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 99.95
d3eaua1326 Voltage-dependent K+ channel beta subunit {Rat (Ra 99.94
d1dxea_ 253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 95.8
d1izca_ 299 Macrophomate synthase {Macrophoma commelinae [TaxI 83.31
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Aldose reductase (aldehyde reductase)
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=1.2e-33  Score=211.81  Aligned_cols=144  Identities=39%  Similarity=0.744  Sum_probs=133.2

Q ss_pred             CHhHHHcCCccEEEeCCCCHHHHHHHHHhCCCCceEEecccCccCCcHHHHHHHHHcCceEEEeccCCCCCCC------C
Q 032162            1 MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNT------H   74 (146)
Q Consensus         1 l~~l~~~G~ir~iGvS~~~~~~l~~~~~~~~~~~~~~q~~~~~~~~~~~~~~~~~~~gi~~~~~~~l~~gg~~------~   74 (146)
                      |++|+++||||+||+|||++.++.++.+.+..++.++|..++......+++++|+++||++++|+||++|.+.      +
T Consensus       146 l~~l~~~G~Ir~iG~Sn~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~gi~~~~~~pl~~g~~~~~~~~~~  225 (324)
T d1hqta_         146 LEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEP  225 (324)
T ss_dssp             HHHHHHTTSBSCEEEESCCHHHHHHHHTTCSSCCCEEEEECBTTBCCHHHHHHHHHHTCEEEEESTTCCTTCSSCCCCSC
T ss_pred             HHHHHHcCCeeeecccCCCHHHHHHHhhhcccCccccccccchhhhhHHHHHHHHHcCCCcccccCccccccccccccch
Confidence            5789999999999999999999999999998899999999999988899999999999999999999988332      2


Q ss_pred             CCCCcHHHHHHHHHhCCCHHHHHHHhhhcCCcEEeecCCCHHHHHHhhcccCccCCHHHHHhhHhhhhhh
Q 032162           75 RVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQSL  144 (146)
Q Consensus        75 ~~~~~~~l~~~a~~~~~s~~~lal~~~l~~~~~~i~g~~~~~~l~~n~~a~~~~L~~~~~~~l~~~~~~~  144 (146)
                      ..+..+.++++|+++|+|++|+||+|++++|.++|+|+++++|+++|+++++++||++|+++|+++.+++
T Consensus       226 ~~~~~~~l~~lA~~~g~s~aq~ALaw~l~~~~~~I~G~~s~eql~en~~a~~~~Ls~ee~~~i~~l~~~~  295 (324)
T d1hqta_         226 VLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRIPQNIQVFDFTFSPEEMKQLDALNKNL  295 (324)
T ss_dssp             CSTTCHHHHHHHHHTTCCHHHHHHHHHHHTTCEECCBCCCTTTHHHHHCCSSCCCCHHHHHHHHTTCCCC
T ss_pred             hhhcchHHHHHHHHhCcCHHHHHHHHHHcCCCEEEECCCCHHHHHHHHhhcCCCCCHHHHHHHhccCcCC
Confidence            3455689999999999999999999999999999999999999999999999999999999999998754
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure