Citrus Sinensis ID: 032182


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVITKLRLDKDRKSLLDRKAKGRAAADKEKGTKFTPEDIMQSVD
ccccccccccHHHHHHHHccccccccEEcccccccHHHHHHHccccEEEECcccEEEEEcccccCEccEEEEEEEcEEEEEcEEEEEECcccEEECccccccEEEEEEEccHHHHHHHHHHHHccccccccccccccHHHHHcccc
*******************TAPSSVRRILMSAPL*TDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVITKLRLDKDRK*******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVITKLRLDKDRKSLLDRKAKGRAAADKEKGTKFTPEDIMQSVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L26-1 confidentP51414
60S ribosomal protein L26-like 1 confidentQ9UNX3
60S ribosomal protein L26 confidentQ2I0I6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain t
Confidence level:very confident
Coverage over the Query: 8-106
View the alignment between query and template
View the model in PyMOL