Citrus Sinensis ID: 032208


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MAPKRGGKVAAAPAKKKPEKVVNPLFEKRPKQFGIGGALPPKKDLHRYVKWPKAIRIQRQRRILRQRLKVPPALNQFTKTLDKNLASSLFKLLLKYRPEDRAAKKERLLKRAQAEAEGKTVEAKKPIVVKYGLNHVTYLIEQMLI
cccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccEEEcccHHHHHHHHHccc
**************************EKRPKQFGIGGALPPKKDLHRYVKWPKAIRIQRQRRILRQRLKVPPALNQFTKTLDKNLASSLFKLLLKYR**************************KKPIVVKYGLNHVTYLIEQMLI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPKRGGKVAAAPAKKKPEKVVNPLFEKRPKQFGIGGALPPKKDLHRYVKWPKAIRIQRQRRILRQRLKVPPALNQFTKTLDKNLASSLFKLLLKYRPEDRxxxxxxxxxxxxxxxxxxxxxAKKPIVVKYGLNHVTYLIEQMLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L7a probableP35685
60S ribosomal protein L7a-1 probableP49692
60S ribosomal protein L7a-2 probableQ9LZH9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain f
Confidence level:very confident
Coverage over the Query: 98-143
View the alignment between query and template
View the model in PyMOL