Citrus Sinensis ID: 032209

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MDVVSQLQKQFIDFSSSLYREGYVDDQFSQLHKLQDESSPDFVVEVASLFFDDAEKLINSMARALEQPCVDFKQVDSHVHQLKGSSSSIGALRVKNVCIAFRSFCDAQNREGCMRCLQQVSHEYTMLKSKLQTLFRVSVKACGNS
ccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
*********QFIDFSSSLYREGYVDDQFSQLHKLQDESSPDFVVEVASLFFDDAEKLINSMARALEQPCVDFKQVDSHVHQLKGSSSSIGALRVKNVCIAFRSFCDAQNREGCMRCLQQVSHEYTMLKSKLQTLFRVSVKAC***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVVSQLQKQFIDFSSSLYREGYVDDQFSQLHKLQDESSPDFVVEVASLFFDDAEKLINSMARALEQPCVDFKQVDSHVHQLKGSSSSIGALRVKNVCIAFRSFCDAQNREGCMRCLQQVSHEYTMLKSKLQTLFRVSVKACGNS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histidine-containing phosphotransfer protein 5 Functions as two-component phosphorelay mediators between cytokinin sensor histidine kinases and response regulators (B-type ARRs). Plays an important role in propagating cytokinin signal transduction through the multistep His-to-Asp phosphorelay.probableQ8L9T7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3US6, chain A
Confidence level:very confident
Coverage over the Query: 4-145
View the alignment between query and template
View the model in PyMOL