Citrus Sinensis ID: 032230


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MAALSSAMVSTSFIRNKPTVTSLKAMPNMGQALFGLKANNNRGGRVIAMATYKVKLITPEGEQEIECPDDTYILDAAEDAGIDLPYSCRAGSCSTCAGKVVSGSVDQSDGSFLEDDQIDAGYVLTCVAYPTSDVTVETHKDEEMS
cccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccEEEEEccccccHHHHHHHccccccccccccccccccEEEEEEEEEccccccccHHHHHccEEEEEEcEEcccEEEEcccccccc
*****************************************RGGRVIAMATYKVKLITPEGEQEIECPDDTYILDAAEDAGIDLPYSCRAGSCSTCAGKVVSGSVDQSDGSFLEDDQIDAGYVLTCVAYPTSDVTVETHK*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAALSSAMVSTSFIRNKPTVTSLKAMPNMGQALFGLKANNNRGGRVIAMATYKVKLITPEGEQEIECPDDTYILDAAEDAGIDLPYSCRAGSCSTCAGKVVSGSVDQSDGSFLEDDQIDAGYVLTCVAYPTSDVTVETHKDEEMS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ferredoxin-2, chloroplastic Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.confidentP16972
Ferredoxin-1, chloroplastic Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.probableO04683
Ferredoxin-1 Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.probableP31965

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1A70, chain A
Confidence level:very confident
Coverage over the Query: 51-145
View the alignment between query and template
View the model in PyMOL
Template: 1DOI, chain A
Confidence level:very confident
Coverage over the Query: 26-140
View the alignment between query and template
View the model in PyMOL