Citrus Sinensis ID: 032243


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MQWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCCST
ccccccccHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccHHHHHHHHHHccccEEEccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccc
MQWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASI**********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCCST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein Rab-1A Probably required for transit of protein from the ER through Golgi compartment. Binds GTP and GDP and possesses intrinsic GTPase activity.probableQ52NJ2
Ras-related protein Rab-1A Probably required for transit of protein from the ER through Golgi compartment. Binds GTP and GDP and possesses intrinsic GTPase activity.probableQ6NYB7
Ras-related protein Rab-1A Probably required for transit of protein from the ER through Golgi compartment. Binds GTP and GDP and possesses intrinsic GTPase activity.probableP62820

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TKL, chain A
Confidence level:very confident
Coverage over the Query: 1-114
View the alignment between query and template
View the model in PyMOL
Template: 2BOV, chain A
Confidence level:very confident
Coverage over the Query: 1-113
View the alignment between query and template
View the model in PyMOL