Citrus Sinensis ID: 032245


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MASLATIAAVQPATIKGLGGSSLAGTKLTVKPTRQSFRPKSFKAGAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSTLAYFSATASGDILPIKKGPQLPPKLGPRGKI
cccccHHHHccccccccccccccccccEEEcccccccccccccccEEEEEEccCEEEEEcccccccccccCECcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccEEEEECcccccccccccccccccccccccccc
****ATIAAVQPATIKGLGGSSLAG****************FKAGAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSTLAYFSATASGDILP*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASLATIAAVQPATIKGLGGSSLAGTKLTVKPTRQSFRPKSFKAGAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSTLAYFSATASGDILPIKKGPQLPPKLGPRGKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Photosystem I reaction center subunit VI, chloroplastic Possible role could be the docking of the LHC I antenna complex to the core complex.confidentQ0DG05
Photosystem I reaction center subunit VI-2, chloroplastic Possible role could be the docking of the LHC I antenna complex to the core complex.confidentQ9SUI6
Photosystem I reaction center subunit VI, chloroplastic Possible role could be the docking of the LHC I antenna complex to the core complex.probableO04006

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WSC, chain H
Confidence level:very confident
Coverage over the Query: 59-127
View the alignment between query and template
View the model in PyMOL