Citrus Sinensis ID: 032253

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MKKRGWQSRFLVEAVGLLFFLLLGNAPTATEADHSVSAFVQNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNGEHIGGADGWSQLSLAHSTYLKAAVLSGQLQQLLGTS
ccccccccEEEEEEcEEEEEEEcccccccccHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHcccccccEEEccCEEcccHHHHHHHHHcHHHHHHHHHcccHHHHHccc
****GWQSRFLVEAVGLLFFLLLGNAPTATEADHSVSAFVQNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNGEHIGGADGWSQLSLAHSTYLKAAVLSGQLQQLLG**
xxxxxxxxxxHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKRGWQSRFLVEAVGLLFFLLLGNAPTATEADHSVSAFVQNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNGEHIGGADGWSQLSLAHSTYLKAAVLSGQLQQLLGTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutaredoxin-C3 Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.probableQ9FVX1
Monothiol glutaredoxin-S6 May only reduce GSH-thiol disulfides, but not protein disulfides.probableQ6H628

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H8Q, chain A
Confidence level:very confident
Coverage over the Query: 34-116,128-142
View the alignment between query and template
View the model in PyMOL