Citrus Sinensis ID: 032253


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MKKRGWQSRFLVEAVGLLFFLLLGNAPTATEADHSVSAFVQNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNGEHIGGADGWSQLSLAHSTYLKAAVLSGQLQQLLGTS
ccccccccEEEEEEcEEEEEEEcccccccccHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHcccccccEEEccEEEcccHHHHHHHHHcHHHHHHHHHcccHHHHHccc
cccccHHHHHHHHccEEEEEEEcccccccHcHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHccccccEEEEcccEEcccHHHHHHHHcccccHHHHHHcccHHHHHccc
mkkrgwqsRFLVEAVGLLFFLLlgnaptateadhsvSAFVQNSIFSNKIVIFsksycpycLRAKRIFadlneqpfvveldlrddgAQIQYILLDLVgrrtvpqifvngehiggadgwsqlsLAHSTYLKAAVLSGQLQQLLGTS
mkkrgwqsrFLVEAVGLLFFLLLGNAPTATEADHSVSAFVQNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNGEHIGGADGWSQLSLAHSTYLKAAVLSGQLQQLLGTS
MKKRGWQSRFLVEAVGLLFFLLLGNAPTATEADHSVSAFVQNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNGEHIGGADGWSQLSLAHSTYLKAAVLSGqlqqllGTS
*****WQSRFLVEAVGLLFFLLLGNAPTATEADHSVSAFVQNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNGEHIGGADGWSQLSLAHSTYLKAAVLSGQL*******
****GWQ*RFLVEAVGLLFFLLL*****************QNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNGEHIGGADGWSQLSLAHS*********GQLQQLLG**
MKKRGWQSRFLVEAVGLLFFLLLGNAPTATEADHSVSAFVQNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNGEHIGGADGWSQLSLAHSTYLKAAVLSGQLQQLLGTS
****GWQSRFLVEAVGLLFFLLLGNAPTATEADHSVSAFVQNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNGEHIGGADGWSQLSLAHSTYLKAAVLSGQLQQL*G**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKRGWQSRFLVEAVGLLFFLLLGNAPTATEADHSVSAFVQNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNGEHIGGADGWSQLSLAHSTYLKAAVLSGQLQQLLGTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query144 2.2.26 [Sep-21-2011]
Q9FVX1130 Glutaredoxin-C3 OS=Arabid yes no 0.881 0.976 0.608 1e-39
Q6H628131 Monothiol glutaredoxin-S6 yes no 0.819 0.900 0.569 3e-36
Q8LFQ6135 Glutaredoxin-C4 OS=Arabid no no 0.777 0.829 0.476 1e-27
Q0DAE4136 Glutaredoxin-C8 OS=Oryza no no 0.666 0.705 0.495 3e-24
Q6K953133 Glutaredoxin-C4, chloropl no no 0.5 0.541 0.486 2e-17
P55143102 Glutaredoxin OS=Ricinus c N/A no 0.5 0.705 0.486 2e-17
Q9FNE2111 Glutaredoxin-C2 OS=Arabid no no 0.534 0.693 0.480 3e-17
P55142112 Glutaredoxin-C6 OS=Oryza no no 0.541 0.696 0.435 4e-17
Q9NS18164 Glutaredoxin-2, mitochond yes no 0.638 0.560 0.464 6e-17
Q32L67157 Glutaredoxin-2, mitochond yes no 0.701 0.643 0.438 8e-17
>sp|Q9FVX1|GRXC3_ARATH Glutaredoxin-C3 OS=Arabidopsis thaliana GN=GRXC3 PE=2 SV=1 Back     alignment and function desciption
 Score =  161 bits (408), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 84/138 (60%), Positives = 100/138 (72%), Gaps = 11/138 (7%)

Query: 7   QSRFLVEAVGLLFFLLLGNAPTATEADHSVSAFVQNSIFSNKIVIFSKSYCPYCLRAKRI 66
           QS   V    LL F++L +   +  A +SVSAFVQN+I SNKIVIFSKSYCPYCLR+KRI
Sbjct: 4   QSPRRVVVAALLLFVVLCDLSNSAGAANSVSAFVQNAILSNKIVIFSKSYCPYCLRSKRI 63

Query: 67  FADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNGEHIGGADGWSQLSLAHST 126
           F+ L E+PFVVELD R+DG QIQY LL+ VGRRTVPQ+FVNG+HIGG+D           
Sbjct: 64  FSQLKEEPFVVELDQREDGDQIQYELLEFVGRRTVPQVFVNGKHIGGSDD---------- 113

Query: 127 YLKAAVLSGQLQQLLGTS 144
            L AA+ SGQLQ+LL  S
Sbjct: 114 -LGAALESGQLQKLLAAS 130




Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.
Arabidopsis thaliana (taxid: 3702)
>sp|Q6H628|GRXS6_ORYSJ Monothiol glutaredoxin-S6 OS=Oryza sativa subsp. japonica GN=GRXS6 PE=2 SV=1 Back     alignment and function description
>sp|Q8LFQ6|GRXC4_ARATH Glutaredoxin-C4 OS=Arabidopsis thaliana GN=GRXC4 PE=2 SV=2 Back     alignment and function description
>sp|Q0DAE4|GRXC8_ORYSJ Glutaredoxin-C8 OS=Oryza sativa subsp. japonica GN=GRXC8 PE=2 SV=2 Back     alignment and function description
>sp|Q6K953|GRXC4_ORYSJ Glutaredoxin-C4, chloroplastic OS=Oryza sativa subsp. japonica GN=GRXC4 PE=3 SV=1 Back     alignment and function description
>sp|P55143|GLRX_RICCO Glutaredoxin OS=Ricinus communis PE=3 SV=1 Back     alignment and function description
>sp|Q9FNE2|GRXC2_ARATH Glutaredoxin-C2 OS=Arabidopsis thaliana GN=GRXC2 PE=2 SV=1 Back     alignment and function description
>sp|P55142|GRXC6_ORYSJ Glutaredoxin-C6 OS=Oryza sativa subsp. japonica GN=GRXC6 PE=1 SV=2 Back     alignment and function description
>sp|Q9NS18|GLRX2_HUMAN Glutaredoxin-2, mitochondrial OS=Homo sapiens GN=GLRX2 PE=1 SV=1 Back     alignment and function description
>sp|Q32L67|GLRX2_BOVIN Glutaredoxin-2, mitochondrial OS=Bos taurus GN=GLRX2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
225431233128 PREDICTED: glutaredoxin-C3 [Vitis vinife 0.763 0.859 0.685 6e-40
351723431129 uncharacterized protein LOC100527634 pre 0.895 1.0 0.583 5e-39
224097096134 glutaredoxin C3 [Populus trichocarpa] gi 0.75 0.805 0.680 8e-39
255585971135 glutaredoxin-1, grx1, putative [Ricinus 0.861 0.918 0.623 8e-39
357483591129 Glutaredoxin C3 [Medicago truncatula] gi 0.895 1.0 0.583 2e-38
388512909133 unknown [Lotus japonicus] 0.833 0.902 0.614 2e-38
351720938129 uncharacterized protein LOC100500348 pre 0.895 1.0 0.576 3e-38
449464518141 PREDICTED: glutaredoxin-C3-like [Cucumis 0.902 0.921 0.605 4e-38
388494562127 unknown [Medicago truncatula] 0.736 0.834 0.666 4e-38
217074828129 unknown [Medicago truncatula] 0.895 1.0 0.576 4e-38
>gi|225431233|ref|XP_002273515.1| PREDICTED: glutaredoxin-C3 [Vitis vinifera] gi|297735061|emb|CBI17423.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  168 bits (426), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 83/121 (68%), Positives = 96/121 (79%), Gaps = 11/121 (9%)

Query: 24  GNAPTATEADHSVSAFVQNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRD 83
            NAP  T A +SV AFVQN+I++NKI IFSKSYCPYCLRAKRIF++L+E+PFVVELD RD
Sbjct: 19  ANAPGQTLASNSVPAFVQNTIYANKIAIFSKSYCPYCLRAKRIFSELHEEPFVVELDHRD 78

Query: 84  DGAQIQYILLDLVGRRTVPQIFVNGEHIGGADGWSQLSLAHSTYLKAAVLSGQLQQLLGT 143
           DG QIQ +LLDLVGR TVPQIFVNG+HIGG+D            L+ AVLSGQLQ+ LGT
Sbjct: 79  DGTQIQNVLLDLVGRSTVPQIFVNGKHIGGSDD-----------LRNAVLSGQLQKQLGT 127

Query: 144 S 144
           S
Sbjct: 128 S 128




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|351723431|ref|NP_001235231.1| uncharacterized protein LOC100527634 precursor [Glycine max] gi|255632820|gb|ACU16763.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224097096|ref|XP_002310834.1| glutaredoxin C3 [Populus trichocarpa] gi|222853737|gb|EEE91284.1| glutaredoxin C3 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255585971|ref|XP_002533656.1| glutaredoxin-1, grx1, putative [Ricinus communis] gi|223526451|gb|EEF28727.1| glutaredoxin-1, grx1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357483591|ref|XP_003612082.1| Glutaredoxin C3 [Medicago truncatula] gi|355513417|gb|AES95040.1| Glutaredoxin C3 [Medicago truncatula] gi|388517957|gb|AFK47040.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388512909|gb|AFK44516.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|351720938|ref|NP_001236681.1| uncharacterized protein LOC100500348 precursor [Glycine max] gi|255630095|gb|ACU15401.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449464518|ref|XP_004149976.1| PREDICTED: glutaredoxin-C3-like [Cucumis sativus] gi|449528591|ref|XP_004171287.1| PREDICTED: glutaredoxin-C3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388494562|gb|AFK35347.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|217074828|gb|ACJ85774.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
TAIR|locus:2031452130 AT1G77370 [Arabidopsis thalian 0.756 0.838 0.669 7.4e-34
TAIR|locus:2149942135 AT5G20500 "AT5G20500" [Arabido 0.666 0.711 0.539 1.6e-24
FB|FBgn0034658116 Grx-1 "Grx-1" [Drosophila mela 0.604 0.75 0.5 6.5e-19
UNIPROTKB|E1C928 604 TXNRD3 "Uncharacterized protei 0.527 0.125 0.513 4.5e-18
UNIPROTKB|F1PUT1161 GLRX2 "Uncharacterized protein 0.743 0.664 0.403 1.4e-16
ZFIN|ZDB-GENE-040718-101170 glrx2 "glutaredoxin 2" [Danio 0.569 0.482 0.487 1.8e-16
DICTYBASE|DDB_G0271084169 DDB_G0271084 "glutaredoxin fam 0.541 0.461 0.493 4.7e-16
CGD|CAL0003046156 orf19.6509 [Candida albicans ( 0.576 0.532 0.441 6e-16
DICTYBASE|DDB_G0290015100 grxA "glutaredoxin" [Dictyoste 0.562 0.81 0.469 6e-16
UNIPROTKB|Q9NS18164 GLRX2 "Glutaredoxin-2, mitocho 0.625 0.548 0.474 6e-16
TAIR|locus:2031452 AT1G77370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 368 (134.6 bits), Expect = 7.4e-34, P = 7.4e-34
 Identities = 73/109 (66%), Positives = 87/109 (79%)

Query:     7 QSRFLVEAVGLLFFLLLGNAPTATEADHSVSAFVQNSIFSNKIVIFSKSYCPYCLRAKRI 66
             QS   V    LL F++L +   +  A +SVSAFVQN+I SNKIVIFSKSYCPYCLR+KRI
Sbjct:     4 QSPRRVVVAALLLFVVLCDLSNSAGAANSVSAFVQNAILSNKIVIFSKSYCPYCLRSKRI 63

Query:    67 FADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNGEHIGGAD 115
             F+ L E+PFVVELD R+DG QIQY LL+ VGRRTVPQ+FVNG+HIGG+D
Sbjct:    64 FSQLKEEPFVVELDQREDGDQIQYELLEFVGRRTVPQVFVNGKHIGGSD 112




GO:0005737 "cytoplasm" evidence=ISM
GO:0008794 "arsenate reductase (glutaredoxin) activity" evidence=ISS
GO:0009055 "electron carrier activity" evidence=IEA
GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
TAIR|locus:2149942 AT5G20500 "AT5G20500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0034658 Grx-1 "Grx-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1C928 TXNRD3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PUT1 GLRX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-101 glrx2 "glutaredoxin 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0271084 DDB_G0271084 "glutaredoxin family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
CGD|CAL0003046 orf19.6509 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290015 grxA "glutaredoxin" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NS18 GLRX2 "Glutaredoxin-2, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6H628GRXS6_ORYSJNo assigned EC number0.56920.81940.9007yesno
Q9FVX1GRXC3_ARATHNo assigned EC number0.60860.88190.9769yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
cd0341982 cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) fam 3e-38
TIGR0218084 TIGR02180, GRX_euk, Glutaredoxin 2e-30
cd0206672 cd02066, GRX_family, Glutaredoxin (GRX) family; co 2e-26
pfam0046260 pfam00462, Glutaredoxin, Glutaredoxin 5e-20
cd0341875 cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) fam 4e-18
COG069580 COG0695, GrxC, Glutaredoxin and related proteins [ 8e-18
TIGR0218179 TIGR02181, GRX_bact, Glutaredoxin, GrxC family 4e-16
TIGR0218999 TIGR02189, GlrX-like_plant, Glutaredoxin-like fami 4e-14
TIGR0219079 TIGR02190, GlrX-dom, Glutaredoxin-family domain 6e-13
PRK1063883 PRK10638, PRK10638, glutaredoxin 3; Provisional 3e-12
PRK1120085 PRK11200, grxA, glutaredoxin 1; Provisional 5e-12
cd0302972 cd03029, GRX_hybridPRX5, Glutaredoxin (GRX) family 9e-12
cd0297673 cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is 2e-09
TIGR0219674 TIGR02196, GlrX_YruB, Glutaredoxin-like protein, Y 3e-08
TIGR0218386 TIGR02183, GRXA, Glutaredoxin, GrxA family 1e-07
PRK12759 410 PRK12759, PRK12759, bifunctional gluaredoxin/ribon 1e-06
cd0302773 cd03027, GRX_DEP, Glutaredoxin (GRX) family, Dishe 8e-06
PHA03050108 PHA03050, PHA03050, glutaredoxin; Provisional 8e-06
COG0278105 COG0278, COG0278, Glutaredoxin-related protein [Po 2e-05
COG5429 261 COG5429, COG5429, Uncharacterized secreted protein 7e-04
COG0526127 COG0526, TrxA, Thiol-disulfide isomerase and thior 8e-04
cd0302890 cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family 0.004
>gnl|CDD|239511 cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
 Score =  124 bits (313), Expect = 3e-38
 Identities = 43/93 (46%), Positives = 58/93 (62%), Gaps = 11/93 (11%)

Query: 48  KIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVN 107
            +V+FSKSYCPYC RAK +  +L  +P VVELD  +DG++IQ  L +L G+RTVP +F+ 
Sbjct: 1   PVVVFSKSYCPYCKRAKSLLKELGVKPAVVELDQHEDGSEIQDYLQELTGQRTVPNVFIG 60

Query: 108 GEHIGGADGWSQLSLAHSTYLKAAVLSGQLQQL 140
           G+ IGG D            L A   SG+L +L
Sbjct: 61  GKFIGGCDD-----------LMALHKSGKLVKL 82


GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH -> GSH reductase -> GSH -> GRX -> protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known including human GRX1 and GRX2, which are members of this subfamily. Also included in this subfamily are the N-terminal GRX domains of proteins similar to human thioredoxin reductase 1 and 3. Length = 82

>gnl|CDD|233765 TIGR02180, GRX_euk, Glutaredoxin Back     alignment and domain information
>gnl|CDD|239017 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|215931 pfam00462, Glutaredoxin, Glutaredoxin Back     alignment and domain information
>gnl|CDD|239510 cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|223767 COG0695, GrxC, Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233766 TIGR02181, GRX_bact, Glutaredoxin, GrxC family Back     alignment and domain information
>gnl|CDD|233771 TIGR02189, GlrX-like_plant, Glutaredoxin-like family Back     alignment and domain information
>gnl|CDD|131245 TIGR02190, GlrX-dom, Glutaredoxin-family domain Back     alignment and domain information
>gnl|CDD|182607 PRK10638, PRK10638, glutaredoxin 3; Provisional Back     alignment and domain information
>gnl|CDD|183036 PRK11200, grxA, glutaredoxin 1; Provisional Back     alignment and domain information
>gnl|CDD|239327 cd03029, GRX_hybridPRX5, Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>gnl|CDD|239274 cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>gnl|CDD|131251 TIGR02196, GlrX_YruB, Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>gnl|CDD|131238 TIGR02183, GRXA, Glutaredoxin, GrxA family Back     alignment and domain information
>gnl|CDD|139206 PRK12759, PRK12759, bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|239325 cd03027, GRX_DEP, Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>gnl|CDD|165343 PHA03050, PHA03050, glutaredoxin; Provisional Back     alignment and domain information
>gnl|CDD|223355 COG0278, COG0278, Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227716 COG5429, COG5429, Uncharacterized secreted protein [Function unknown] Back     alignment and domain information
>gnl|CDD|223600 COG0526, TrxA, Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|239326 cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 144
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 99.95
PRK10824115 glutaredoxin-4; Provisional 99.94
KOG1752104 consensus Glutaredoxin and related proteins [Postt 99.94
PHA03050108 glutaredoxin; Provisional 99.94
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 99.93
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 99.9
PTZ00062204 glutaredoxin; Provisional 99.89
PRK1063883 glutaredoxin 3; Provisional 99.88
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 99.88
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 99.88
COG0278105 Glutaredoxin-related protein [Posttranslational mo 99.86
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 99.86
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 99.84
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 99.84
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 99.83
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 99.8
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 99.8
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 99.79
PRK1120085 grxA glutaredoxin 1; Provisional 99.78
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 99.78
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 99.73
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 99.72
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 99.69
KOG0911227 consensus Glutaredoxin-related protein [Posttransl 99.69
cd0303092 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 99.66
PRK1032981 glutaredoxin-like protein; Provisional 99.65
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 99.65
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 99.56
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 99.47
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 99.4
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 99.38
KOG2824281 consensus Glutaredoxin-related protein [Posttransl 99.37
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 99.24
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 99.17
PF0490899 SH3BGR: SH3-binding, glutamic acid-rich protein; I 99.1
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 99.04
PHA0212575 thioredoxin-like protein 99.01
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 98.98
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 98.94
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 98.91
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 98.85
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 98.85
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 98.84
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.83
PHA02278103 thioredoxin-like protein 98.81
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 98.8
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 98.76
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 98.76
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 98.71
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 98.68
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 98.68
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 98.67
cd02962152 TMX2 TMX2 family; composed of proteins similar to 98.66
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 98.64
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 98.64
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 98.63
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 98.63
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 98.62
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 98.62
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 98.61
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 98.6
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 98.6
PTZ0005198 thioredoxin; Provisional 98.59
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 98.58
COG2143182 Thioredoxin-related protein [Posttranslational mod 98.56
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 98.54
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 98.53
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 98.52
PRK10996139 thioredoxin 2; Provisional 98.52
PRK09381109 trxA thioredoxin; Provisional 98.5
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 98.49
PTZ00443224 Thioredoxin domain-containing protein; Provisional 98.49
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 98.48
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 98.47
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 98.45
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 98.45
cd0294793 TRX_family TRX family; composed of two groups: Gro 98.44
cd02955124 SSP411 TRX domain, SSP411 protein family; members 98.43
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 98.43
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 98.4
PRK01655131 spxA transcriptional regulator Spx; Reviewed 98.39
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 98.39
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 98.39
KOG0907106 consensus Thioredoxin [Posttranslational modificat 98.39
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 98.38
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 98.38
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 98.38
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 98.37
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 98.35
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 98.35
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 98.35
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 98.33
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 98.33
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 98.33
COG3118 304 Thioredoxin domain-containing protein [Posttransla 98.33
COG454585 Glutaredoxin-related protein [Posttranslational mo 98.29
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 98.28
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 98.27
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 98.27
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 98.26
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 98.25
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 98.25
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 98.23
PTZ00102 477 disulphide isomerase; Provisional 98.23
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 98.22
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 98.21
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 98.21
PRK12559131 transcriptional regulator Spx; Provisional 98.2
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 98.19
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 98.19
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 98.19
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 98.18
PRK10877232 protein disulfide isomerase II DsbC; Provisional 98.16
PRK00293571 dipZ thiol:disulfide interchange protein precursor 98.16
PRK03147173 thiol-disulfide oxidoreductase; Provisional 98.15
PRK13344132 spxA transcriptional regulator Spx; Reviewed 98.13
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 98.11
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 98.11
PTZ00062204 glutaredoxin; Provisional 98.1
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 98.1
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 98.01
COG3634 520 AhpF Alkyl hydroperoxide reductase, large subunit 98.0
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 97.98
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 97.97
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 97.97
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 97.95
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 97.94
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 97.93
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 97.91
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 97.9
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 97.86
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 97.85
PRK13728181 conjugal transfer protein TrbB; Provisional 97.83
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 97.76
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 97.73
TIGR02740271 TraF-like TraF-like protein. This protein is relat 97.73
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 97.73
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 97.71
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 97.71
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 97.7
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 97.69
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 97.69
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 97.67
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 97.58
KOG3029 370 consensus Glutathione S-transferase-related protei 97.58
PF13728215 TraF: F plasmid transfer operon protein 97.57
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 97.57
TIGR00014114 arsC arsenate reductase (glutaredoxin). composed o 97.55
PRK10026141 arsenate reductase; Provisional 97.53
PLN02309457 5'-adenylylsulfate reductase 97.53
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 97.52
PRK10853118 putative reductase; Provisional 97.49
KOG0908 288 consensus Thioredoxin-like protein [Posttranslatio 97.49
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s 97.47
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 97.47
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 97.46
KOG4023108 consensus Uncharacterized conserved protein [Funct 97.45
COG1393117 ArsC Arsenate reductase and related proteins, glut 97.42
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 97.38
TIGR01616126 nitro_assoc nitrogenase-associated protein. This m 97.38
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 97.38
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 97.36
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 97.33
cd02958114 UAS UAS family; UAS is a domain of unknown functio 97.33
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 97.32
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 97.32
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 97.32
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 97.31
TIGR02182 209 GRXB Glutaredoxin, GrxB family. This model include 97.28
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 97.25
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 97.24
COG3019149 Predicted metal-binding protein [General function 97.19
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 97.16
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 97.16
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 97.15
PRK09481 211 sspA stringent starvation protein A; Provisional 97.15
PF13462162 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV 97.12
KOG4277 468 consensus Uncharacterized conserved protein, conta 97.12
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 97.08
smart00594122 UAS UAS domain. 97.07
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 97.06
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 97.05
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA 97.04
PTZ00102477 disulphide isomerase; Provisional 97.01
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 97.0
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 96.99
cd02967114 mauD Methylamine utilization (mau) D family; mauD 96.94
PF06764202 DUF1223: Protein of unknown function (DUF1223); In 96.93
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 96.88
PF03960110 ArsC: ArsC family; InterPro: IPR006660 Several bac 96.88
TIGR02739256 TraF type-F conjugative transfer system pilin asse 96.85
PRK10387 210 glutaredoxin 2; Provisional 96.85
COG5429 261 Uncharacterized secreted protein [Function unknown 96.83
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 96.83
PRK13703248 conjugal pilus assembly protein TraF; Provisional 96.82
COG4232569 Thiol:disulfide interchange protein [Posttranslati 96.8
KOG3425128 consensus Uncharacterized conserved protein [Funct 96.8
PRK15113 214 glutathione S-transferase; Provisional 96.73
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 96.63
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 96.61
KOG2501157 consensus Thioredoxin, nucleoredoxin and related p 96.6
KOG0190 493 consensus Protein disulfide isomerase (prolyl 4-hy 96.52
PTZ00056199 glutathione peroxidase; Provisional 96.52
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 96.45
TIGR00862 236 O-ClC intracellular chloride channel protein. Thes 96.41
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 96.3
PRK10954207 periplasmic protein disulfide isomerase I; Provisi 96.28
COG5494 265 Predicted thioredoxin/glutaredoxin [Posttranslatio 96.17
PF0731593 DUF1462: Protein of unknown function (DUF1462); In 96.12
PLN02378 213 glutathione S-transferase DHAR1 96.1
KOG0406 231 consensus Glutathione S-transferase [Posttranslati 96.09
PLN02473 214 glutathione S-transferase 96.07
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 96.03
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 96.0
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 95.96
PLN02817 265 glutathione dehydrogenase (ascorbate) 95.9
KOG1731 606 consensus FAD-dependent sulfhydryl oxidase/quiesci 95.87
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 95.87
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 95.83
TIGR01262 210 maiA maleylacetoacetate isomerase. Maleylacetoacet 95.83
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 95.7
KOG0191 383 consensus Thioredoxin/protein disulfide isomerase 95.57
KOG1422 221 consensus Intracellular Cl- channel CLIC, contains 95.43
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 95.32
COG2999 215 GrxB Glutaredoxin 2 [Posttranslational modificatio 95.05
COG1651244 DsbG Protein-disulfide isomerase [Posttranslationa 95.05
PHA03075123 glutaredoxin-like protein; Provisional 95.0
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 94.61
COG0625 211 Gst Glutathione S-transferase [Posttranslational m 94.59
KOG3414142 consensus Component of the U4/U6.U5 snRNP/mitosis 94.49
PTZ00256183 glutathione peroxidase; Provisional 94.33
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 94.17
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 94.14
PF06953123 ArsD: Arsenical resistance operon trans-acting rep 94.08
KOG0868 217 consensus Glutathione S-transferase [Posttranslati 94.07
PLN02412167 probable glutathione peroxidase 94.01
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 93.95
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 93.84
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 93.8
PF11009105 DUF2847: Protein of unknown function (DUF2847); In 93.77
COG4837106 Uncharacterized protein conserved in bacteria [Fun 93.7
PRK13972 215 GSH-dependent disulfide bond oxidoreductase; Provi 93.65
PLN02395 215 glutathione S-transferase 93.52
PRK11752 264 putative S-transferase; Provisional 93.5
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 93.42
PRK10357 202 putative glutathione S-transferase; Provisional 93.39
KOG0912 375 consensus Thiol-disulfide isomerase and thioredoxi 93.32
KOG0913 248 consensus Thiol-disulfide isomerase and thioredoxi 92.95
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 92.85
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 92.49
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 92.39
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 92.32
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 91.97
cd03019178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m 91.8
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 90.84
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 90.4
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 90.3
PF02966133 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th 90.06
KOG0191 383 consensus Thioredoxin/protein disulfide isomerase 89.74
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 89.69
KOG1672211 consensus ATP binding protein [Posttranslational m 89.58
PRK10606183 btuE putative glutathione peroxidase; Provisional 89.09
PF0456663 RNA_pol_Rpb2_4: RNA polymerase Rpb2, domain 4; Int 88.88
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 88.8
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 88.79
KOG0867 226 consensus Glutathione S-transferase [Posttranslati 88.25
PF04134114 DUF393: Protein of unknown function, DUF393; Inter 88.13
KOG2603 331 consensus Oligosaccharyltransferase, gamma subunit 88.1
cd03022192 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-car 87.53
PTZ00057 205 glutathione s-transferase; Provisional 86.62
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 86.49
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 85.9
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 85.85
KOG0914265 consensus Thioredoxin-like protein [Posttranslatio 85.33
KOG4244 281 consensus Failed axon connections (fax) protein/gl 84.55
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 84.49
PRK10542 201 glutathionine S-transferase; Provisional 83.75
PF01323193 DSBA: DSBA-like thioredoxin domain; InterPro: IPR0 83.02
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 82.11
PF0717295 GRP: Glycine rich protein family; InterPro: IPR010 81.03
PF11287112 DUF3088: Protein of unknown function (DUF3088); In 80.96
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
Probab=99.95  E-value=3.6e-27  Score=157.41  Aligned_cols=92  Identities=33%  Similarity=0.538  Sum_probs=81.2

Q ss_pred             HhhhcCCcEEEEecCCChhHHHHHHHHHhcCCCCeEEEEeCCCCHHHHHHHHHHHcCCCcccEEEECCEEEeccCCcchh
Q 032253           41 QNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNGEHIGGADGWSQL  120 (144)
Q Consensus        41 ~~~~~~~~Vvvf~~~~Cp~C~~~~~~L~~~~~~~~~~~id~~~~~~~~~~~l~~~~g~~~vP~vfi~g~~igg~~e~~~~  120 (144)
                      ++++++++|+||++++||||.+++++|+++++.+.++++|.+.+..+.++++.+.+|++++|+|||||++|||+++    
T Consensus         2 ~~~i~~~~Vvvysk~~Cp~C~~ak~~L~~~~i~~~~vdid~~~~~~~~~~~l~~~tg~~tvP~Vfi~g~~iGG~dd----   77 (99)
T TIGR02189         2 RRMVSEKAVVIFSRSSCCMCHVVKRLLLTLGVNPAVHEIDKEPAGKDIENALSRLGCSPAVPAVFVGGKLVGGLEN----   77 (99)
T ss_pred             hhhhccCCEEEEECCCCHHHHHHHHHHHHcCCCCEEEEcCCCccHHHHHHHHHHhcCCCCcCeEEECCEEEcCHHH----
Confidence            4678899999999999999999999999999764456666555556667788999999999999999999999999    


Q ss_pred             hhhhhHHHHHHHHcCchhHhhcc
Q 032253          121 SLAHSTYLKAAVLSGQLQQLLGT  143 (144)
Q Consensus       121 ~~~~~~~~~~~~~~g~L~~~l~~  143 (144)
                             +.+|+++|+|+++|++
T Consensus        78 -------l~~l~~~G~L~~~l~~   93 (99)
T TIGR02189        78 -------VMALHISGSLVPMLKQ   93 (99)
T ss_pred             -------HHHHHHcCCHHHHHHH
Confidence                   9999999999999964



This family of glutaredoxin-like proteins is aparrently limited to plants. Multiple isoforms are found in A. thaliana and O.sativa.

>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>KOG2824 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>TIGR00014 arsC arsenate reductase (glutaredoxin) Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>PRK10853 putative reductase; Provisional Back     alignment and domain information
>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>KOG4023 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>TIGR01616 nitro_assoc nitrogenase-associated protein Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>COG3019 Predicted metal-binding protein [General function prediction only] Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A Back     alignment and domain information
>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>PF06764 DUF1223: Protein of unknown function (DUF1223); InterPro: IPR010634 This family consists of several hypothetical proteins of around 250 residues in length, which are found in both plants and bacteria Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information
>PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>COG5429 Uncharacterized secreted protein [Function unknown] Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>KOG3425 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>PRK10954 periplasmic protein disulfide isomerase I; Provisional Back     alignment and domain information
>COG5494 Predicted thioredoxin/glutaredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07315 DUF1462: Protein of unknown function (DUF1462); InterPro: IPR009190 There are currently no experimental data for members of this group of bacterial proteins or their homologues Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1651 DsbG Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03075 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3414 consensus Component of the U4/U6 Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>PF06953 ArsD: Arsenical resistance operon trans-acting repressor ArsD; InterPro: IPR010712 This family consists of several bacterial arsenical resistance operon trans-acting repressor ArsD proteins Back     alignment and domain information
>KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol Back     alignment and domain information
>COG4837 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>KOG1672 consensus ATP binding protein [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>PF04566 RNA_pol_Rpb2_4: RNA polymerase Rpb2, domain 4; InterPro: IPR007646 RNA polymerases catalyse the DNA dependent polymerisation of RNA Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04134 DUF393: Protein of unknown function, DUF393; InterPro: IPR007263 The DCC family, named after the conserved N-terminal DxxCxxC motif, encompasses COG3011 from COG Back     alignment and domain information
>KOG2603 consensus Oligosaccharyltransferase, gamma subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03022 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>PF01323 DSBA: DSBA-like thioredoxin domain; InterPro: IPR001853 DSBA is a sub-family of the Thioredoxin family [] Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins Back     alignment and domain information
>PF11287 DUF3088: Protein of unknown function (DUF3088); InterPro: IPR021439 This family of proteins with unknown function appears to be restricted to Proteobacteria Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
2ht9_A146 The Structure Of Dimeric Human Glutaredoxin 2 Lengt 3e-18
2fls_A132 Crystal Structure Of Human Glutaredoxin 2 Complexed 5e-18
2cq9_A130 Solution Structure Of Rsgi Ruh-044, An N-Terminal D 5e-18
3h8q_A114 Crystal Structure Of Glutaredoxin Domain Of Human T 6e-16
3rhb_A113 Crystal Structure Of The Apo Form Of Glutaredoxin C 2e-15
3fz9_A112 Crystal Structure Of Poplar Glutaredoxin S12 In Com 2e-14
2e7p_A116 Crystal Structure Of The Holo Form Of Glutaredoxin 2e-13
1z7p_A117 Solution Structure Of Reduced Glutaredoxin C1 From 2e-13
3c1r_A118 Crystal Structure Of Oxidized Grx1 Length = 118 4e-12
3ctf_A129 Crystal Structure Of Oxidized Grx2 Length = 129 6e-12
3d4m_A109 Glutaredoxin 2 Oxidized Structure Length = 109 7e-12
2jac_A110 Glutaredoxin Grx1p C30s Mutant From Yeast Length = 6e-11
3d5j_A112 Structure Of Yeast Grx2-C30s Mutant With Glutathion 8e-11
2jad_A362 Yellow Fluorescent Protein - Glutaredoxin Fusion Pr 9e-11
3h4k_A 598 Crystal Structure Of The Wild Type Thioredoxin Glut 5e-10
2v6o_A 596 Structure Of Schistosoma Mansoni Thioredoxin-Glutat 5e-10
2x8c_A 598 Thioredoxin Glutathione Reductase From Schistosoma 5e-10
1kte_A105 Crystal Structure Of Thioltransferase At 2.2 Angstr 6e-09
1nm3_A241 Crystal Structure Of Heamophilus Influenza Hybrid-p 2e-08
1jhb_A106 Human Glutaredoxin In Fully Reduced Form, Nmr, 20 S 4e-08
1b4q_A105 Solution Structure Of Human Thioltransferase Comple 1e-07
1fov_A82 Glutaredoxin 3 From Escherichia Coli In The Fully O 6e-07
2khp_A92 Solution Structure Of Glutaredoxin From Brucella Me 2e-06
1ego_A85 Nmr Structure Of Oxidized Escherichia Coli Glutared 5e-06
3grx_A82 Nmr Structure Of Escherichia Coli Glutaredoxin 3-Gl 7e-06
3l4n_A127 Crystal Structure Of Yeast Monothiol Glutaredoxin G 8e-06
2klx_A89 Solution Structure Of Glutaredoxin From Bartonella 9e-06
3lgc_A89 Crystal Structure Of Glutaredoxin 1 From Francisell 1e-05
3qmx_A99 X-Ray Crystal Structure Of Synechocystis Sp. Pcc 68 2e-05
1qfn_A85 Glutaredoxin-1-Ribonucleotide Reductase B1 Mixed Di 6e-05
2hze_A114 Crystal Structures Of A Poxviral Glutaredoxin In Th 1e-04
>pdb|2HT9|A Chain A, The Structure Of Dimeric Human Glutaredoxin 2 Length = 146 Back     alignment and structure

Iteration: 1

Score = 87.0 bits (214), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 46/99 (46%), Positives = 58/99 (58%), Gaps = 7/99 (7%) Query: 40 VQNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRDDGAQIQYILLDLVGRR 99 +Q +I N +VIFSK+ C YC AK++F D+N VVELDL + G Q Q L + G R Sbjct: 42 IQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGER 101 Query: 100 TVPQIFVNGEHIGGADGWSQLS-------LAHSTYLKAA 131 TVP+IFVNG IGGA +L L H YLK + Sbjct: 102 TVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKS 140
>pdb|2FLS|A Chain A, Crystal Structure Of Human Glutaredoxin 2 Complexed With Glutathione Length = 132 Back     alignment and structure
>pdb|2CQ9|A Chain A, Solution Structure Of Rsgi Ruh-044, An N-Terminal Domain Of Glutaredoxin 2 From Human Cdna Length = 130 Back     alignment and structure
>pdb|3H8Q|A Chain A, Crystal Structure Of Glutaredoxin Domain Of Human Thioredoxin Reductase 3 Length = 114 Back     alignment and structure
>pdb|3RHB|A Chain A, Crystal Structure Of The Apo Form Of Glutaredoxin C5 From Arabidopsis Thaliana Length = 113 Back     alignment and structure
>pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex With Glutathione Length = 112 Back     alignment and structure
>pdb|2E7P|A Chain A, Crystal Structure Of The Holo Form Of Glutaredoxin C1 From Populus Tremula X Tremuloides Length = 116 Back     alignment and structure
>pdb|1Z7P|A Chain A, Solution Structure Of Reduced Glutaredoxin C1 From Populus Tremula X Tremuloides Length = 117 Back     alignment and structure
>pdb|3C1R|A Chain A, Crystal Structure Of Oxidized Grx1 Length = 118 Back     alignment and structure
>pdb|3CTF|A Chain A, Crystal Structure Of Oxidized Grx2 Length = 129 Back     alignment and structure
>pdb|3D4M|A Chain A, Glutaredoxin 2 Oxidized Structure Length = 109 Back     alignment and structure
>pdb|2JAC|A Chain A, Glutaredoxin Grx1p C30s Mutant From Yeast Length = 110 Back     alignment and structure
>pdb|3D5J|A Chain A, Structure Of Yeast Grx2-C30s Mutant With Glutathionyl Mixed Disulfide Length = 112 Back     alignment and structure
>pdb|2JAD|A Chain A, Yellow Fluorescent Protein - Glutaredoxin Fusion Protein Length = 362 Back     alignment and structure
>pdb|3H4K|A Chain A, Crystal Structure Of The Wild Type Thioredoxin Glutatione Reductase From Schistosoma Mansoni In Complex With Auranofin Length = 598 Back     alignment and structure
>pdb|2V6O|A Chain A, Structure Of Schistosoma Mansoni Thioredoxin-Glutathione Reductase (Smtgr) Length = 596 Back     alignment and structure
>pdb|2X8C|A Chain A, Thioredoxin Glutathione Reductase From Schistosoma Mansoni With The Reduced C-Terminal End Length = 598 Back     alignment and structure
>pdb|1KTE|A Chain A, Crystal Structure Of Thioltransferase At 2.2 Angstrom Resolution Length = 105 Back     alignment and structure
>pdb|1NM3|A Chain A, Crystal Structure Of Heamophilus Influenza Hybrid-prx5 Length = 241 Back     alignment and structure
>pdb|1JHB|A Chain A, Human Glutaredoxin In Fully Reduced Form, Nmr, 20 Structures Length = 106 Back     alignment and structure
>pdb|1B4Q|A Chain A, Solution Structure Of Human Thioltransferase Complex With Glutathione Length = 105 Back     alignment and structure
>pdb|1FOV|A Chain A, Glutaredoxin 3 From Escherichia Coli In The Fully Oxidized Form Length = 82 Back     alignment and structure
>pdb|2KHP|A Chain A, Solution Structure Of Glutaredoxin From Brucella Melitensis Length = 92 Back     alignment and structure
>pdb|1EGO|A Chain A, Nmr Structure Of Oxidized Escherichia Coli Glutaredoxin: Comparison With Reduced E. Coli Glutaredoxin And Functionally Related Proteins Length = 85 Back     alignment and structure
>pdb|3GRX|A Chain A, Nmr Structure Of Escherichia Coli Glutaredoxin 3-Glutathione Mixed Disulfide Complex, 20 Structures Length = 82 Back     alignment and structure
>pdb|3L4N|A Chain A, Crystal Structure Of Yeast Monothiol Glutaredoxin Grx6 Length = 127 Back     alignment and structure
>pdb|2KLX|A Chain A, Solution Structure Of Glutaredoxin From Bartonella Henselae Str. Houston Length = 89 Back     alignment and structure
>pdb|3LGC|A Chain A, Crystal Structure Of Glutaredoxin 1 From Francisella Tularensis Length = 89 Back     alignment and structure
>pdb|3QMX|A Chain A, X-Ray Crystal Structure Of Synechocystis Sp. Pcc 6803 Glutaredoxin A Length = 99 Back     alignment and structure
>pdb|1QFN|A Chain A, Glutaredoxin-1-Ribonucleotide Reductase B1 Mixed Disulfide Bond Length = 85 Back     alignment and structure
>pdb|2HZE|A Chain A, Crystal Structures Of A Poxviral Glutaredoxin In The Oxidized And Reduced States Show Redox-Correlated Structural Changes Length = 114 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 9e-44
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 4e-43
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 6e-43
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 1e-42
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 8e-42
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 7e-41
1kte_A105 Thioltransferase; redox-active center, electron tr 2e-40
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 2e-40
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 6e-40
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 1e-38
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 9e-32
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 1e-29
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 4e-27
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 4e-27
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 2e-25
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 8e-25
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 2e-23
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 2e-21
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 2e-20
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 5e-18
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 3e-16
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 7e-16
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 1e-13
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 1e-11
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 2e-11
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 1e-07
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 6e-07
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 7e-07
3ir4_A 218 Glutaredoxin 2; glutathione, IDP00895, structural 2e-04
2axo_A 270 Hypothetical protein ATU2684; alpha beta protein., 3e-04
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 4e-04
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 130 Back     alignment and structure
 Score =  139 bits (352), Expect = 9e-44
 Identities = 44/118 (37%), Positives = 60/118 (50%), Gaps = 11/118 (9%)

Query: 24  GNAPTATEADHSVSAFVQNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVELDLRD 83
           G++ +      +    +Q +I  N +VIFSK+ C YC  AK++F D+N    VVELDL +
Sbjct: 4   GSSGSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLE 63

Query: 84  DGAQIQYILLDLVGRRTVPQIFVNGEHIGGADGWSQLSLAHSTYLKAAVLSGQLQQLL 141
            G Q Q  L  + G RTVP+IFVNG  IGGA                    G+L  L+
Sbjct: 64  YGNQFQDALYKMTGERTVPRIFVNGTFIGGAT-----------DTHRLHKEGKLLPLV 110


>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} Length = 114 Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Length = 146 Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Length = 118 Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Length = 116 Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Length = 129 Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Length = 105 Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Length = 113 Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Length = 114 Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Length = 127 Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} Length = 99 Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Length = 362 Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Length = 89 Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Length = 92 Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Length = 82 Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Length = 85 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Length = 89 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Length = 92 Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Length = 103 Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Length = 75 Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Length = 81 Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Length = 87 Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Length = 241 Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Length = 93 Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Length = 121 Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Length = 106 Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Length = 270 Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Length = 100 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 99.94
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 99.93
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 99.93
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 99.93
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 99.93
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 99.93
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 99.92
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 99.91
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 99.91
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 99.91
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 99.91
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 99.9
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 99.9
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 99.89
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 99.89
1kte_A105 Thioltransferase; redox-active center, electron tr 99.87
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 99.87
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 99.86
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 99.86
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 99.85
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 99.85
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 99.85
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 99.83
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 99.81
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 99.81
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 99.8
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 99.77
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 99.77
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 99.75
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 99.71
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 99.7
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 99.69
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 99.68
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 99.65
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 99.65
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 99.59
1ttz_A87 Conserved hypothetical protein; structural genomic 99.56
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 99.5
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 99.49
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 99.48
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 99.34
2axo_A 270 Hypothetical protein ATU2684; alpha beta protein., 99.31
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 99.19
1z3e_A132 Regulatory protein SPX; bacterial transcription re 99.13
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.12
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 99.12
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 99.09
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 99.08
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 99.08
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 99.06
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 99.04
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 99.01
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 98.95
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 98.94
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 98.93
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 98.93
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 98.92
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 98.89
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 98.89
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 98.88
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 98.88
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 98.87
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 98.87
1zma_A118 Bacterocin transport accessory protein; alpha-beta 98.86
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 98.86
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 98.85
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 98.84
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 98.83
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 98.81
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 98.81
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 98.81
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 98.8
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 98.8
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 98.8
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 98.79
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 98.78
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 98.78
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 98.78
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 98.77
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 98.77
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 98.76
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 98.76
4euy_A105 Uncharacterized protein; structural genomics, PSI- 98.75
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 98.73
2yzu_A109 Thioredoxin; redox protein, electron transport, st 98.72
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 98.72
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 98.71
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 98.7
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 98.69
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 98.69
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 98.68
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 98.67
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 98.67
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 98.66
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 98.66
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 98.66
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 98.64
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 98.64
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 98.64
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 98.64
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 98.63
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 98.63
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 98.62
2l5l_A136 Thioredoxin; structural genomics, electron transpo 98.61
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 98.6
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 98.59
2l57_A126 Uncharacterized protein; structural genomics, unkn 98.59
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 98.59
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 98.58
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 98.58
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 98.58
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 98.56
2kuc_A130 Putative disulphide-isomerase; structural genomics 98.55
3rdw_A121 Putative arsenate reductase; structural genomics, 98.55
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 98.53
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 98.52
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 98.51
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 98.51
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 98.5
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 98.49
3l78_A120 Regulatory protein SPX; transcription, transcripti 98.48
1mek_A120 Protein disulfide isomerase; electron transport, r 98.48
3fz4_A120 Putative arsenate reductase; APC61768, structural 98.46
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.46
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 98.45
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 98.45
1wmj_A130 Thioredoxin H-type; structural genomics, program f 98.44
3gkx_A120 Putative ARSC family related protein; ARSC family 98.44
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 98.43
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 98.43
3f9u_A172 Putative exported cytochrome C biogenesis-related; 98.42
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 98.42
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.41
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 98.41
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 98.39
2qsi_A137 Putative hydrogenase expression/formation protein; 98.39
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 97.75
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 98.39
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 98.38
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 98.37
2lrn_A152 Thiol:disulfide interchange protein; structural ge 98.37
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 98.36
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 98.36
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 97.69
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 98.31
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 98.28
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 98.27
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 98.26
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 98.26
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 98.26
3idv_A 241 Protein disulfide-isomerase A4; thioredoxin-like f 98.26
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 98.25
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 98.25
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 98.25
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoe 98.25
3ira_A173 Conserved protein; methanosarcina mazei,structural 98.25
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 98.25
1a8l_A 226 Protein disulfide oxidoreductase; PDI, thioredoxin 98.18
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 98.18
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 98.17
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 98.15
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 98.13
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 98.12
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 98.12
2lrt_A152 Uncharacterized protein; structural genomics, thio 98.11
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 98.1
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 98.08
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 98.06
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 98.05
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 98.05
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 98.04
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 98.03
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 98.02
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 98.01
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 98.0
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 98.0
3hd5_A195 Thiol:disulfide interchange protein DSBA; protein 97.97
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 97.21
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 97.96
1z6m_A175 Conserved hypothetical protein; structural genomic 97.95
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 97.94
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 97.93
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 97.92
4hoj_A 210 REGF protein; GST, glutathione S-transferase, enzy 97.92
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 97.92
3raz_A151 Thioredoxin-related protein; structural genomics, 97.92
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 97.9
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 97.9
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 97.9
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 97.89
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 97.89
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 97.89
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 97.88
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 97.88
4hi7_A 228 GI20122; GST, glutathione S-transferase, enzyme fu 97.88
3ir4_A 218 Glutaredoxin 2; glutathione, IDP00895, structural 97.87
3q6o_A 244 Sulfhydryl oxidase 1; protein disulfide isomerase, 97.87
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 97.86
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 97.85
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 97.85
4evm_A138 Thioredoxin family protein; structural genomics, n 97.84
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 97.81
4g10_A 265 Glutathione S-transferase homolog; thioredoxin fol 97.79
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 97.79
3h93_A192 Thiol:disulfide interchange protein DSBA; disulfid 97.79
2ahe_A 267 Chloride intracellular channel protein 4; glutathi 97.79
2l5o_A153 Putative thioredoxin; structural genomics, unknown 97.78
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 97.77
2r4v_A 247 XAP121, chloride intracellular channel protein 2; 97.71
3qav_A 243 RHO-class glutathione S-transferase; cytosol; 2.10 97.68
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 97.61
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 97.6
4dvc_A184 Thiol:disulfide interchange protein DSBA; pilus as 97.6
2ls5_A159 Uncharacterized protein; structural genomics, unkn 96.71
1k0m_A 241 CLIC1, NCC27, chloride intracellular channel prote 97.54
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase 97.53
1e6b_A 221 Glutathione S-transferase; 1.65A {Arabidopsis thal 97.53
3vk9_A 216 Glutathione S-transferase delta; glutathione bindi 97.52
1v2a_A 210 Glutathione transferase GST1-6; glutathione S-tran 97.51
3bby_A 215 Uncharacterized GST-like protein YFCF; NP_416804.1 97.5
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredo 97.5
1axd_A 209 Glutathione S-transferase I; transferase, herbicid 97.5
3hz8_A193 Thiol:disulfide interchange protein DSBA; thiol-ox 97.5
1yy7_A 213 SSPA, stringent starvation protein A; GST fold, tr 97.49
3vln_A 241 GSTO-1, glutathione S-transferase omega-1; GST fol 97.48
1oyj_A 231 Glutathione S-transferase; herbicide detoxificatio 97.48
3ay8_A 216 Glutathione S-transferase; GST fold, GST binding, 97.48
2ywm_A 229 Glutaredoxin-like protein; redox protein, structur 97.46
2imi_A 221 Epsilon-class glutathione S-transferase; HET: GSH; 97.45
3lyk_A 216 Stringent starvation protein A homolog; structural 97.45
1gnw_A 211 Glutathione S-transferase; herbicide detoxificatio 97.45
4iel_A 229 Glutathione S-transferase, N-terminal domain PROT; 97.44
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 97.44
2hls_A 243 Protein disulfide oxidoreductase; thioredoxin fold 97.44
2cz2_A 223 Maleylacetoacetate isomerase; structural genomics, 97.43
1pn9_A 209 GST class-delta, glutathione S-transferase 1-6; pr 97.42
1gwc_A 230 Glutathione S-transferase TSI-1; herbicide detoxif 97.41
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 97.4
2c3n_A 247 Glutathione S-transferase theta 1; glutathione tra 97.39
2ywi_A196 Hypothetical conserved protein; uncharacterized co 97.39
2v6k_A 214 Maleylpyruvate isomerase; glutathione-S-transferas 97.38
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 97.38
4glt_A 225 Glutathione S-transferase-like protein; structural 97.37
2vo4_A 219 2,4-D inducible glutathione S-transferase; herbici 97.36
3f6d_A 219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 97.36
4f03_A 253 Glutathione transferase; GST fold; 1.80A {Phaneroc 97.35
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 97.35
3lxz_A 229 Glutathione S-transferase family protein; structur 97.34
3fy7_A 250 Chloride intracellular channel protein 3; GST, glu 97.34
1ljr_A 244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 97.33
3lyp_A 215 Stringent starvation protein A; structural genomic 97.32
1aw9_A 216 Glutathione S-transferase III; herbicide detoxific 97.31
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 97.31
1r5a_A 218 Glutathione transferase; glutathione S-transferase 97.3
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 97.3
4dej_A 231 Glutathione S-transferase related protein; transfe 97.3
1k0d_A 260 URE2 protein; nitrate assimilation, structural gen 97.3
1zl9_A 207 GST class-sigma, glutathione S-transferase 5; glut 97.29
2on5_A 206 Nagst-2, Na glutathione S-transferase 2; hookworm; 97.28
3ein_A 209 GST class-theta, glutathione S-transferase 1-1; de 97.28
1yq1_A 208 Glutathione S-transferase; nematoda, structural ge 97.27
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 97.27
3m3m_A 210 Glutathione S-transferase; PSI-II, structural geno 97.27
3m8n_A 225 Possible glutathione S-transferase; PSI-II, struct 97.26
3ibh_A 233 GST-II, saccharomyces cerevisiae GTT2; glutathione 97.25
1xg8_A111 Hypothetical protein SA0798; structural genomics, 97.25
1okt_A 211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 97.25
3q18_A 239 GSTO-2, glutathione S-transferase omega-2; glutath 97.23
3rbt_A 246 Glutathione transferase O1; glutathione S-transfer 97.23
3ic8_A 310 Uncharacterized GST-like proteinprotein; glutathio 97.22
2ws2_A 204 NU-class GST, glutathione S-transferase; parasite, 97.22
1z9h_A 290 Membrane-associated prostaglandin E synthase-2; me 97.22
4hz2_A 230 Glutathione S-transferase domain; glutathione,enzy 97.21
3n5o_A 235 Glutathione transferase; seattle structural genomi 97.2
3niv_A 222 Glutathione S-transferase; structural genomics, PS 97.2
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 97.17
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 97.15
3ubk_A 242 Glutathione transferase; GSH binding; 1.95A {Lepto 97.15
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 97.14
2on7_A 206 Nagst-1, Na glutathione S-transferase 1; hookworm; 97.13
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 97.12
2cvd_A 198 Glutathione-requiring prostaglandin D synthase; gl 97.11
3m0f_A 213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 97.09
2a2r_A 210 Glutathione S-transferase P; detoxification, nitri 97.08
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 97.08
1tw9_A 206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 97.05
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 97.04
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 97.03
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 97.01
2hnl_A 225 Glutathione S-transferase 1; prostaglandin synthas 96.99
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 96.99
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 96.98
2gsq_A 202 Squid GST, glutathione S-transferase; squid digest 96.97
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 96.92
3tou_A 226 Glutathione S-transferase protein; GSH binding sit 96.91
4id0_A 214 Glutathione S-transferase-like protein YIBF; GST, 96.88
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 96.87
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 96.82
1vf1_A 229 Glutathione S-transferase 3; detoxification; HET: 96.78
3cbu_A 214 Probable GST-related protein; thioredoxin fold, GS 96.76
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 96.76
3r2q_A 202 Uncharacterized GST-like protein YIBF; transferase 96.75
1k3y_A 221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 96.73
3gha_A202 Disulfide bond formation protein D; BDBD, DSBA-lik 96.68
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 96.66
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 96.65
4exj_A 238 Uncharacterized protein; transferase-like protein, 96.64
1tu7_A 208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 96.64
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 96.62
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 96.55
1m0u_A 249 GST2 gene product; flight muscle protein, sigma, t 96.53
2wb9_A 211 Glutathione transferase sigma class; thioredoxin f 96.53
1b48_A 221 GST, mgsta4-4, protein (glutathione S-transferase) 96.5
4ikh_A 244 Glutathione S-transferase; enzyme function initiat 96.5
3l9s_A191 Thiol:disulfide interchange protein; thioredoxin-f 96.49
3gx0_A 215 GST-like protein YFCG; transferase, glutathione, g 96.49
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 96.42
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 96.41
2yv9_A 291 Chloride intracellular channel EXC-4; chloride ION 96.36
4ecj_A 244 Glutathione S-transferase; transferase-like protei 96.32
3gtu_B 224 Glutathione S-transferase; conjugation, detoxifica 96.3
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 96.3
2yv7_A 260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 96.29
3iso_A 218 Putative glutathione transferase; GST; HET: GSH; 1 96.27
3ik7_A 222 Glutathione S-transferase A4; human GST A4-4, enzy 96.23
1nhy_A 219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 96.2
2qc7_A 240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 96.11
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 96.0
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 96.0
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 95.96
2c4j_A 218 Glutathione S-transferase MU 2; glutathione transf 95.93
2ycd_A 230 Glutathione S-transferase; SOIL bacteria, herbicid 95.89
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 95.84
3ppu_A 352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 95.81
1oe8_A 211 Glutathione S-transferase; schistosomiasis, detoxi 95.81
2fhe_A 216 GST, glutathione S-transferase; transferase-substr 95.69
1dug_A 234 Chimera of glutathione S-transferase-synthetic lin 95.68
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 95.66
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 95.61
3c8e_A 288 YGHU, glutathione S-transferase homologue; glutath 95.58
4hz4_A 217 Glutathione-S-transferase; enzyme function initiat 95.57
3lsz_A 225 Glutathione S-transferase; xenobiotic, biodegradat 95.55
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 95.49
3f4s_A226 Alpha-DSBA1, putative uncharacterized protein; thi 95.48
3tdg_A273 DSBG, putative uncharacterized protein; thioredoxi 95.45
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 95.42
2g2q_A124 Glutaredoxin-2; thioredoxin-fold, oxidoreductase, 95.36
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 95.33
3uem_A 361 Protein disulfide-isomerase; thioredoxin-like doma 95.32
1gsu_A 219 GST, CGSTM1-1, class-MU glutathione S-transferase; 95.31
3kgk_A110 Arsenical resistance operon trans-acting represso; 95.28
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 95.26
2c0g_A 248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 95.14
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 95.08
1n2a_A 201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 95.03
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 95.01
2pvq_A 201 Glutathione S-transferase; xenobiotics detoxificat 94.96
3ktb_A106 Arsenical resistance operon trans-acting represso; 94.91
3uar_A 227 Glutathione S-transferase; GSH binding site; HET: 94.8
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 94.79
1un2_A197 DSBA, thiol-disulfide interchange protein; disulfi 94.75
2x64_A 207 Glutathione-S-transferase; detoxification enzyme; 94.73
1pmt_A 203 PMGST, GST B1-1, glutathione transferase; glutathi 94.56
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 94.53
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 94.35
2dsa_A 203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 94.33
3m1g_A 362 Putative glutathione S-transferase; ECM4-like subf 94.17
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 93.85
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 93.74
4gf0_A 215 Glutathione S-transferase; GST, enzyme function in 93.59
3feu_A185 Putative lipoprotein; alpha-beta structure, struct 93.23
3h1n_A 252 Probable glutathione S-transferase; APC84167, bord 92.97
1f2e_A 201 Glutathione S-transferase; GST complexed with glut 92.91
3l9v_A189 Putative thiol-disulfide isomerase or thioredoxin; 92.78
3a2v_A 249 Probable peroxiredoxin; thioredoxin peroxidase, hy 92.78
1nm3_A 241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 92.63
1psq_A163 Probable thiol peroxidase; structural genomics, NY 92.58
1bg5_A 254 MAB, fusion protein of alpha-Na,K-ATPase with glut 92.08
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 91.94
3bci_A186 Disulfide bond protein A; thiol-disulfide oxidored 91.71
1b8x_A 280 Protein (AML-1B); nuclear matrix targeting signal 91.63
3bci_A186 Disulfide bond protein A; thiol-disulfide oxidored 91.56
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 91.48
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 91.39
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 91.23
3gmf_A205 Protein-disulfide isomerase; oxidoreductase, PSI-2 91.05
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 90.76
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, 90.23
2jsy_A167 Probable thiol peroxidase; solution structure, ant 90.19
3gn3_A182 Putative protein-disulfide isomerase; MCSG, PSI, s 89.7
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 89.43
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 88.99
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 88.98
2imf_A203 HCCA isomerase, 2-hydroxychromene-2-carboxylate is 88.47
3gmf_A205 Protein-disulfide isomerase; oxidoreductase, PSI-2 88.41
3c7m_A195 Thiol:disulfide interchange protein DSBA-like; red 88.22
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 87.87
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 87.11
3keb_A224 Probable thiol peroxidase; structural genomics, AP 86.92
2in3_A 216 Hypothetical protein; DSBA family, FRNE-like subfa 86.84
3me7_A170 Putative uncharacterized protein; electron transfe 86.02
3fz5_A202 Possible 2-hydroxychromene-2-carboxylate isomeras; 85.88
4gci_A 211 Glutathione S-transferase; GST, enzyme function in 85.84
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 85.0
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 84.56
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 84.24
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 83.91
3feu_A185 Putative lipoprotein; alpha-beta structure, struct 83.64
3gn3_A182 Putative protein-disulfide isomerase; MCSG, PSI, s 83.42
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 82.86
2in3_A216 Hypothetical protein; DSBA family, FRNE-like subfa 81.91
4f82_A176 Thioredoxin reductase; structural genomics, niaid, 81.9
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 81.67
2imf_A 203 HCCA isomerase, 2-hydroxychromene-2-carboxylate is 80.41
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 80.14
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
Probab=99.94  E-value=1.9e-27  Score=162.21  Aligned_cols=97  Identities=23%  Similarity=0.388  Sum_probs=86.8

Q ss_pred             hhHHHHHHhhhcCCcEEEEec-----CCChhHHHHHHHHHhcCCCCeEEEEeCCCCHHHHHHHHHHHcCCCcccEEEECC
Q 032253           34 HSVSAFVQNSIFSNKIVIFSK-----SYCPYCLRAKRIFADLNEQPFVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNG  108 (144)
Q Consensus        34 ~~~~~~~~~~~~~~~Vvvf~~-----~~Cp~C~~~~~~L~~~~~~~~~~~id~~~~~~~~~~~l~~~~g~~~vP~vfi~g  108 (144)
                      ..+.+.+++++++++|++|++     |.||||.+++++|+.+++.+| .++|+..++ ++++++.+++|+++||+|||||
T Consensus         7 ~~~~e~i~~~i~~~~VvvF~Kgt~~~P~C~fc~~ak~lL~~~gv~~~-~~~~v~~~~-~~r~~l~~~sg~~TvPqIFI~g   84 (118)
T 2wul_A            7 GGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDY-AAYNVLDDP-ELRQGIKDYSNWPTIPQVYLNG   84 (118)
T ss_dssp             --CHHHHHHHHHHSSEEEEESBCSSSBSSHHHHHHHHHHHHTTCCSC-EEEETTSCH-HHHHHHHHHHTCCSSCEEEETT
T ss_pred             cchHHHHHHHHhcCCEEEEEcCCCCCCCCHHHHHHHHHHHHhCCcCe-EeecccCCH-HHHHHHHHhccCCCCCeEeECC
Confidence            445778999999999999998     469999999999999997554 788998885 5699999999999999999999


Q ss_pred             EEEeccCCcchhhhhhhHHHHHHHHcCchhHhhcc
Q 032253          109 EHIGGADGWSQLSLAHSTYLKAAVLSGQLQQLLGT  143 (144)
Q Consensus       109 ~~igg~~e~~~~~~~~~~~~~~~~~~g~L~~~l~~  143 (144)
                      ++|||+|+           +.+|+++|+|+++|++
T Consensus        85 ~~IGG~Dd-----------l~~l~~~GeL~~lL~~  108 (118)
T 2wul_A           85 EFVGGCDI-----------LLQMHQNGDLVEELKK  108 (118)
T ss_dssp             EEEECHHH-----------HHHHHHHTHHHHHHHH
T ss_pred             EEECCHHH-----------HHHHHHCCCHHHHHHH
Confidence            99999999           9999999999999974



>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>1xg8_A Hypothetical protein SA0798; structural genomics, protein structure initative, MCSG, PSI, protein structure initiative; 2.10A {Staphylococcus aureus subsp} SCOP: c.47.1.17 Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis} PDB: 3f4r_A* 3f4t_A* Back     alignment and structure
>3tdg_A DSBG, putative uncharacterized protein; thioredoxin fold, reductase, oxidoreductase; HET: P6G; 2.10A {Helicobacter pylori} Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>2g2q_A Glutaredoxin-2; thioredoxin-fold, oxidoreductase, poxvirus; 2.50A {Vaccinia virus} Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>3kgk_A Arsenical resistance operon trans-acting represso; alpha+beta, chaperone, DNA-binding, RE transcription, transcription regulation; 1.40A {Escherichia coli} PDB: 3mwh_A Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>3ktb_A Arsenical resistance operon trans-acting represso; alpha-beta-alpha sandwich, helix-turn-helix, structural GENO PSI-2; 2.10A {Bacteroides vulgatus} Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans} Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural GEN protein structure initiative, midwest center for structural genomics; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>2imf_A HCCA isomerase, 2-hydroxychromene-2-carboxylate isomerase; glutathione, KGST, kappa GST, transferase; HET: GSH TOM CXS; 1.30A {Pseudomonas putida} PDB: 2ime_A* 2imd_A* Back     alignment and structure
>3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans} Back     alignment and structure
>3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} PDB: 3l9u_A Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>2in3_A Hypothetical protein; DSBA family, FRNE-like subfamily, disulfide isomerase, struc genomics, PSI-2, protein structure initiative; 1.85A {Nitrosomonas europaea} Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>3fz5_A Possible 2-hydroxychromene-2-carboxylate isomeras; 2-hydroxychromene-2-carboxylate ISO structural genomics, PSI-2; HET: MSE GSH PGE; 2.40A {Rhodobacter sphaeroides 2} Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 Back     alignment and structure
>3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural GEN protein structure initiative, midwest center for structural genomics; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>2in3_A Hypothetical protein; DSBA family, FRNE-like subfamily, disulfide isomerase, struc genomics, PSI-2, protein structure initiative; 1.85A {Nitrosomonas europaea} Back     alignment and structure
>4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>2imf_A HCCA isomerase, 2-hydroxychromene-2-carboxylate isomerase; glutathione, KGST, kappa GST, transferase; HET: GSH TOM CXS; 1.30A {Pseudomonas putida} PDB: 2ime_A* 2imd_A* Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 144
d1ktea_105 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 9e-24
d1egoa_85 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 5e-22
d1nm3a174 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hyb 3e-20
d1fova_82 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 2e-19
d1wika_109 c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (M 3e-19
d1h75a_76 c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Esch 2e-17
d1r7ha_74 c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Cory 2e-17
d1abaa_87 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 7e-15
d1t1va_93 c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [Tax 8e-11
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 105 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Thioltransferase
domain: Glutaredoxin (Grx, thioltransferase)
species: Pig (Sus scrofa) [TaxId: 9823]
 Score = 86.7 bits (214), Expect = 9e-24
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 14/107 (13%)

Query: 38  AFVQNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQPFVVEL---DLRDDGAQIQYILLD 94
           AFV + I   K+V+F K  CP+C + + + + L  +  ++E        D  +IQ  L  
Sbjct: 3   AFVNSKIQPGKVVVFIKPTCPFCRKTQELLSQLPFKEGLLEFVDITATSDTNEIQDYLQQ 62

Query: 95  LVGRRTVPQIFVNGEHIGGADGWSQLSLAHSTYLKAAVLSGQLQQLL 141
           L G RTVP++F+  E IGG              L++    G+L   L
Sbjct: 63  LTGARTVPRVFIGKECIGGCTD-----------LESMHKRGELLTRL 98


>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Length = 85 Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Length = 74 Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Length = 82 Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Length = 74 Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Length = 87 Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 93 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 99.95
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 99.93
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 99.92
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 99.84
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 99.82
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 99.82
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 99.79
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 99.78
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 99.67
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 99.55
d1wjka_100 Thioredoxin-like structure containing protein C330 99.46
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 99.23
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 99.21
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 99.16
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 99.13
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 99.13
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 99.08
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 99.08
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 99.06
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 99.01
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 98.99
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 98.97
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 98.91
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 98.89
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 98.89
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 98.89
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 98.87
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 98.8
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 98.8
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 98.76
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 98.71
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 98.69
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 98.5
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 98.42
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 98.42
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 98.4
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 98.39
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 98.36
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 98.36
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 98.3
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 98.3
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 98.29
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 98.27
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 98.26
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 98.26
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 98.24
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 98.22
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 98.21
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 98.21
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 98.14
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 98.11
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 98.1
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 98.09
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 98.09
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 98.04
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 98.04
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 98.01
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 98.0
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 97.99
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 97.94
d1z6ma1172 Hypothetical protein EF0770 {Enterococcus faecalis 97.92
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 97.9
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 97.9
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 97.89
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 97.89
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 97.86
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 97.85
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 97.76
d1beda_181 Disulfide-bond formation facilitator (DsbA) {Vibri 97.67
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 97.66
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 97.65
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 97.64
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 97.63
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 97.62
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 97.62
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 97.58
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 97.51
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 97.5
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 97.48
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 97.48
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 97.16
d1xg8a_111 Hypothetical protein SA0798 {Staphylococcus aureus 97.15
d1fvka_188 Disulfide-bond formation facilitator (DsbA) {Esche 97.12
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 96.74
d1j9ba_138 Arsenate reductase ArsC {Escherichia coli [TaxId: 96.72
d2axoa1 225 Hypothetical protein Atu2684 {Agrobacterium tumefa 96.59
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 96.53
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 96.11
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 95.61
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 95.47
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 95.15
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 94.91
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 94.84
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 94.57
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 94.16
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 93.46
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 93.11
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 93.09
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 93.02
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 92.93
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 91.33
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 89.96
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 89.27
d1un2a_ 195 Disulfide-bond formation facilitator (DsbA) {Esche 87.36
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 86.98
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 85.26
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 84.64
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 84.55
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Thioltransferase
domain: Glutaredoxin (Grx, thioltransferase)
species: Pig (Sus scrofa) [TaxId: 9823]
Probab=99.95  E-value=4e-28  Score=161.01  Aligned_cols=96  Identities=33%  Similarity=0.602  Sum_probs=87.9

Q ss_pred             HHHHHhhhcCCcEEEEecCCChhHHHHHHHHHhcCCCC---eEEEEeCCCCHHHHHHHHHHHcCCCcccEEEECCEEEec
Q 032253           37 SAFVQNSIFSNKIVIFSKSYCPYCLRAKRIFADLNEQP---FVVELDLRDDGAQIQYILLDLVGRRTVPQIFVNGEHIGG  113 (144)
Q Consensus        37 ~~~~~~~~~~~~Vvvf~~~~Cp~C~~~~~~L~~~~~~~---~~~~id~~~~~~~~~~~l~~~~g~~~vP~vfi~g~~igg  113 (144)
                      .+.+++.+++++|+||++++||||.+++++|+++++.+   .+.++|...++..+++.+.+.+|++++|+|||||++|||
T Consensus         2 ~~~v~~~i~~~~Vviysk~~Cp~C~~ak~ll~~~~~~~~~~~~~e~d~~~d~~~~~~~l~~~~g~~tvPqIfi~g~~IGG   81 (105)
T d1ktea_           2 QAFVNSKIQPGKVVVFIKPTCPFCRKTQELLSQLPFKEGLLEFVDITATSDTNEIQDYLQQLTGARTVPRVFIGKECIGG   81 (105)
T ss_dssp             HHHHHHHCCTTCEEEEECSSCHHHHHHHHHHHHSCBCTTSEEEEEGGGSTTHHHHHHHHHHHHSCCCSCEEEETTEEEES
T ss_pred             hhHHHHHhccCCEEEEECCCCchHHHHHHHHHHhCCccceeeeeecccccccHHHHHHHhhccCCCcCcEEEECCEEEec
Confidence            46788899999999999999999999999999998542   267889999988888899999999999999999999999


Q ss_pred             cCCcchhhhhhhHHHHHHHHcCchhHhhcc
Q 032253          114 ADGWSQLSLAHSTYLKAAVLSGQLQQLLGT  143 (144)
Q Consensus       114 ~~e~~~~~~~~~~~~~~~~~~g~L~~~l~~  143 (144)
                      ++|           +.+++++|+|+++|++
T Consensus        82 ~~e-----------l~~l~~~G~L~~~L~~  100 (105)
T d1ktea_          82 CTD-----------LESMHKRGELLTRLQQ  100 (105)
T ss_dssp             HHH-----------HHHHHHHTHHHHHHHH
T ss_pred             HHH-----------HHHHHHCCCHHHHHHH
Confidence            999           9999999999999974



>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xg8a_ c.47.1.17 (A:) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure