Citrus Sinensis ID: 032296

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MGIRFILMVNKQGQTRLAQYYEWLTLEERRALEGEIVRKCLARTEQQCSFVEHRNYKIVYRRYASLFFLVGVDNDENELAILEFIHLLVETMDRHFGNVCELDIMFHLEKAHFMLEEMVMNGCIVETSKSNILSPIQLMEKMS
cEEEEEEEEEccccEEEEEccccccHHHHHHHHHHHHHHHHHccccccccEEEccEEEEEEEEccEEEEEEECccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccEEECccHHHHHHHHHHHHccc
MGIRFILMVNKQGQTRLAQYYEWLTLEERRALEGEIVRKCLARTEQQCSFVEHRNYKIVYRRYASLFFLVGVDNDENELAILEFIHLLVETMDRHFGNVCELDIMFHLEKAHFMLEEMVMNGCIVETSKSNILSPIQLME***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGIRFILMVNKQGQTRLAQYYEWLTLEERRALEGEIVRKCLARTEQQCSFVEHRNYKIVYRRYASLFFLVGVDNDENELAILEFIHLLVETMDRHFGNVCELDIMFHLEKAHFMLEEMVMNGCIVETSKSNILSPIQLMEKMS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
AP-4 complex subunit sigma Subunit of novel type of clathrin- or non-clathrin-associated protein coat involved in targeting proteins from the trans-Golgi network (TGN) to the endosomal-lysosomal system.confidentO82201
AP-4 complex subunit sigma-1 Subunit of novel type of clathrin- or non-clathrin-associated protein coat involved in targeting proteins from the trans-Golgi network (TGN) to the endosomal-lysosomal system.probableQ3ZBB6
AP-4 complex subunit sigma-1 Subunit of novel type of clathrin- or non-clathrin-associated protein coat involved in targeting proteins from the trans-Golgi network (TGN) to the endosomal-lysosomal system.probableQ9WVL1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VGL, chain S
Confidence level:very confident
Coverage over the Query: 2-143
View the alignment between query and template
View the model in PyMOL