Citrus Sinensis ID: 032306


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MAYVFNVQSLGTEFYRLRSSLKAKQEHASLLEDFREFDRTRLDLEDGVGSPEQALLKEHASINRSTGQMDSVISQAQATLGALVFQRSTFGGINSKLSNVSSRLPSVNQILSSIKRKKSMDTIILALVASVCTFLIFIYWVTK
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHc
*AYVFNVQSLGTEFYRLRS*****************************************************ISQAQATLGALVFQRSTFGGINSKLSNVSSRLPSVNQILSSIKRKKSMDTIILALVASVCTFLIFIYWVTK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAYVFNVQSLGTEFYRLRSSLKAKQEHASLLEDFREFDRTRLDLEDGVGSPEQALLKEHASINRSTGQMDSVISQAQATLGALVFQRSTFGGINSKLSNVSSRLPSVNQILSSIKRKKSMDTIILALVASVCTFLIFIYWVTK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Golgi SNAP receptor complex member 1-1 Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide-sensitive factor) attachment protein receptor.probableQ9LMP7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NPS, chain C
Confidence level:confident
Coverage over the Query: 64-120
View the alignment between query and template
View the model in PyMOL
Template: 2L34, chain A
Confidence level:probable
Coverage over the Query: 123-143
View the alignment between query and template
View the model in PyMOL