Citrus Sinensis ID: 032310


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MEASRAEGKRSLKEDDQEEEEDDEDSGGGIAGEEDKIKKKGKRGSSSAGAGGPTTFVSCQVENCRANMTDAKKYHRRHKVCDFHAKAPVVRVEGLAQRFCQQCSRFHELSEFDDTKRSCRRRLAGHNERRRKSSADYHGEGSN
cccccccccccccccccccccccccccccccccccHccccccccccccccccccccccEEccccccHHHHHHHHHHHcccccccccccEEEEcccHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccccccccccc
******************************************************TFVSCQVENCRANMTDAKKYHRRHKVCDFHAKAPVVRVEGLAQRFCQQCSRFHELSEFDDTKR**************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEASRAEGKRSLKEDDQEEEEDDEDSGGGIAGEEDKIKKKGKRGSSSAGAGGPTTFVSCQVENCRANMTDAKKYHRRHKVCDFHAKAPVVRVEGLAQRFCQQCSRFHELSEFDDTKRSCRRRLAGHNERRRKSSADYHGEGSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Squamosa promoter-binding-like protein 3 Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. Promotes both vegetative phase change and flowering. Regulates phase-specific patterns of leaf epidermal differentiation and flowering time, but does not seem to affect leaf shape.probableP93015
Squamosa promoter-binding-like protein 7 Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development.probableQ7XT42
Squamosa promoter-binding-like protein 13 Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development.probableQ6Z461

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UL4, chain A
Confidence level:very confident
Coverage over the Query: 52-136
View the alignment between query and template
View the model in PyMOL