Citrus Sinensis ID: 032311

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MIACVAVVGHQNNPLYIQSFTEADDALKLHHIVHCSLDVVDERVNNPKKSGPTLNETFLGLLYPTENYKVYGYLTNTKVKFILVTTDLDVRDADVRNFFRRFHAAYIDAVSNPFHVPGKKITSRTFAERVSTIVKSFGLSSAG
cEEEEEEEEccccCEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccECcccccccEEEEEEEEcccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccc
MIACVAVVGHQNNPLYIQSFTEADDALKLHHIVHCSLDVVDERVN*******TLNETFLGLLYPTENYKVYGYLTNTKVKFILVTTDLDVRDADVRNFFRRFHAAYIDAVSNPFHVPGKKITSRTFAERVSTIVKSFGLS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIACVAVVGHQNNPLYIQSFTEADDALKLHHIVHCSLDVVDERVNNPKKSGPTLNETFLGLLYPTENYKVYGYLTNTKVKFILVTTDLDVRDADVRNFFRRFHAAYIDAVSNPFHVPGKKITSRTFAERVSTIVKSFGLSSAG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Trafficking protein particle complex subunit 2-like protein May play a role in vesicular transport from endoplasmic reticulum to Golgi.probableA6H7F7
Trafficking protein particle complex subunit 2-like protein probableQ54CU7
Trafficking protein particle complex subunit 2-like protein May play a role in vesicular transport from endoplasmic reticulum to Golgi.probableQ9UL33

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J3W, chain A
Confidence level:very confident
Coverage over the Query: 2-139
View the alignment between query and template
View the model in PyMOL