Citrus Sinensis ID: 032331


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MTEAMIRKKPGMASVKDMPVLQDGPPPGGFAPVRYARRIPTKGPSAMALFLAAFGAFSYGMYQVGKGNKIRRALKEEKYAARRAILPMLQAEEDERFVKEWKKYLEYEAEVMKDVPGWKVGENVYNSGRWMPPASGELRPEVW
ccHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccc
***************K*****QDGPPPGGFAPVRYARRIPTKGPSAMALFLAAFGAFSYGMYQVGKGNKIRRALKEEKYAARRAILPMLQAEEDERFVKEWKKYLEYEAEVMKDVPGWKVGENVYNSGRWMPPASG*L*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEAMIRKKPGMASVKDMPVLQDGPPPGGFAPVRYARRIPTKGPSAMALFLAAFGAFSYGMYQVGKGNKIRRALKEEKYAARRAILPMLQAEEDERFVKEWKKYLEYEAEVMKDVPGWKVGENVYNSGRWMPPASGELRPEVW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-B Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentO49313
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-A Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ8RWA7
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Involved in the interferon/all-trans-retinoic acid (IFN/RA) cell death pathway. May play a role in CARD15-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes.probableQ95KV7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted