Citrus Sinensis ID: 032333


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MAMAFKMATTGMWVADECKNSFMEMKWKKVHRYIVFKIDEKSKLVTVDKVGGAGEGYEDLAASLPDDDCRYAVFDFDFVTVDNCRKSKIFFIAWAPTASRIRAKMLYATSKDGLRRVLDGIHYEVQATDPTEMGFDVIMDRAK
cccccccccccccccHHHHHHHHHHHcccccEEEEEEEEcccCEEEEEEcccccccHHHHHccccccccEEEEEEEEEEcccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHccEEEEEEEcccccccHHHHHHHHc
**********GMWVADECKNSFMEMKWKKVHRYIVFKIDEKSKLVTVDKVGGAGEGYEDLAASLPDDDCRYAVFDFDFVTVDNCRKSKIFFIAWAPTASRIRAKMLYATSKDGLRRVLDGIHYEVQATDPTEMGFDVIMDRAK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMAFKMATTGMWVADECKNSFMEMKWKKVHRYIVFKIDEKSKLVTVDKVGGAGEGYEDLAASLPDDDCRYAVFDFDFVTVDNCRKSKIFFIAWAPTASRIRAKMLYATSKDGLRRVLDGIHYEVQATDPTEMGFDVIMDRAK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Actin-depolymerizing factor 5 Actin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers.confidentQ9ZNT3
Actin-depolymerizing factor 5 Actin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers.confidentQ10P87
Actin-depolymerizing factor 9 Actin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers.probableO49606

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F7S, chain A
Confidence level:very confident
Coverage over the Query: 9-132
View the alignment between query and template
View the model in PyMOL