Citrus Sinensis ID: 032389


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MGKLSLCLLLFLCSLAIAAAQSASNVRATYHLYNPERIGWDLNAARAYCSTWDANKPLAWRRKYGWTAFCGPVGPRGQAACGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVGVFRKLDTDGKGNAQGHLMVNYQFVNCGD
cccHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccccccccccccccccccccccccccccCEEEEccccccccccccccEEEECcccccEEEEEEEEccccccccccHHHHHccccccccccCEEEEEEEEEECccc
***LSLCLLLFLCSLAIAAAQSASNVRATYHLYNPERIGWDLNAARAYCSTWDANKPLAWRRKYGWTAFCGPVGPRGQAACGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVGVFRKLDTDGKGNAQGHLMVNYQFVNCGD
xxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKLSLCLLLFLCSLAIAAAQSASNVRATYHLYNPERIGWDLNAARAYCSTWDANKPLAWRRKYGWTAFCGPVGPRGQAACGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVGVFRKLDTDGKGNAQGHLMVNYQFVNCGD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pathogenesis-related protein PR-4B probableP29063
Pathogenesis-related protein PR-4A probableP29062
Barwin May be involved in a defense mechanism. Probable plant lectin. Binds weakly a chitin analog.probableP28814

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BW3, chain A
Confidence level:very confident
Coverage over the Query: 21-142
View the alignment between query and template
View the model in PyMOL