Citrus Sinensis ID: 032393
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| 147838471 | 271 | hypothetical protein VITISV_038964 [Viti | 0.507 | 0.265 | 0.931 | 3e-32 | |
| 449479514 | 300 | PREDICTED: uncharacterized protein LOC10 | 0.711 | 0.336 | 0.655 | 6e-32 | |
| 449434040 | 300 | PREDICTED: uncharacterized protein LOC10 | 0.711 | 0.336 | 0.655 | 6e-32 | |
| 224139462 | 267 | predicted protein [Populus trichocarpa] | 0.619 | 0.329 | 0.787 | 2e-31 | |
| 359496116 | 210 | PREDICTED: uncharacterized protein LOC10 | 0.514 | 0.347 | 0.904 | 3e-30 | |
| 297735872 | 839 | unnamed protein product [Vitis vinifera] | 0.492 | 0.083 | 0.928 | 7e-30 | |
| 359496109 | 267 | PREDICTED: uncharacterized protein LOC10 | 0.422 | 0.224 | 0.927 | 2e-29 | |
| 351723703 | 262 | uncharacterized protein LOC100527827 [Gl | 0.683 | 0.370 | 0.826 | 5e-28 | |
| 356555759 | 267 | PREDICTED: uncharacterized protein LOC10 | 0.471 | 0.250 | 0.911 | 1e-27 | |
| 356541709 | 204 | PREDICTED: uncharacterized protein LOC10 | 0.964 | 0.671 | 0.570 | 5e-27 |
| >gi|147838471|emb|CAN69857.1| hypothetical protein VITISV_038964 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 143 bits (360), Expect = 3e-32, Method: Compositional matrix adjust.
Identities = 68/73 (93%), Positives = 72/73 (98%)
Query: 30 EIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSG 89
EIVLKVDMHCEACARKVARALKGF+GV+D+T DSKASKVVVKGKTADPIKVCER+QKKSG
Sbjct: 36 EIVLKVDMHCEACARKVARALKGFQGVEDVTTDSKASKVVVKGKTADPIKVCERIQKKSG 95
Query: 90 RKVELISPLPKPP 102
RKVELISPLPKPP
Sbjct: 96 RKVELISPLPKPP 108
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449479514|ref|XP_004155621.1| PREDICTED: uncharacterized protein LOC101226864 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449434040|ref|XP_004134804.1| PREDICTED: uncharacterized protein LOC101208608 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224139462|ref|XP_002323124.1| predicted protein [Populus trichocarpa] gi|222867754|gb|EEF04885.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359496116|ref|XP_003635156.1| PREDICTED: uncharacterized protein LOC100854192 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297735872|emb|CBI18631.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359496109|ref|XP_002273672.2| PREDICTED: uncharacterized protein LOC100257542 [Vitis vinifera] gi|297735874|emb|CBI18633.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|351723703|ref|NP_001238056.1| uncharacterized protein LOC100527827 [Glycine max] gi|255633318|gb|ACU17016.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356555759|ref|XP_003546197.1| PREDICTED: uncharacterized protein LOC100776967 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356541709|ref|XP_003539316.1| PREDICTED: uncharacterized protein LOC100786661 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| TAIR|locus:2163300 | 290 | AT5G50740 [Arabidopsis thalian | 0.471 | 0.231 | 0.701 | 3.9e-21 | |
| TAIR|locus:2167366 | 355 | FP3 "farnesylated protein 3" [ | 0.471 | 0.188 | 0.641 | 5.3e-19 | |
| TAIR|locus:2075497 | 246 | AT3G02960 "AT3G02960" [Arabido | 0.471 | 0.272 | 0.522 | 4.9e-14 | |
| TAIR|locus:2057951 | 386 | AT2G36950 [Arabidopsis thalian | 0.436 | 0.160 | 0.539 | 3.4e-13 | |
| TAIR|locus:2046183 | 245 | AT2G28090 [Arabidopsis thalian | 0.464 | 0.269 | 0.454 | 5.6e-13 | |
| TAIR|locus:2142614 | 392 | AT5G03380 [Arabidopsis thalian | 0.457 | 0.165 | 0.439 | 4.3e-11 | |
| TAIR|locus:2121199 | 153 | FP6 "farnesylated protein 6" [ | 0.443 | 0.411 | 0.468 | 1.2e-10 | |
| TAIR|locus:2089870 | 136 | AT3G21490 "AT3G21490" [Arabido | 0.457 | 0.477 | 0.409 | 1.5e-10 | |
| TAIR|locus:2156927 | 147 | HIPP27 "heavy metal associated | 0.450 | 0.435 | 0.4 | 1.4e-09 | |
| TAIR|locus:2153969 | 319 | AT5G24580 "AT5G24580" [Arabido | 0.471 | 0.210 | 0.352 | 2.5e-09 |
| TAIR|locus:2163300 AT5G50740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 248 (92.4 bits), Expect = 3.9e-21, P = 3.9e-21
Identities = 47/67 (70%), Positives = 57/67 (85%)
Query: 30 EIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSG 89
EIVLK+ MHCE CA+K+ R LKGFEGV+D+T D K SKVVVKG+ ADP+KV +RLQ+KS
Sbjct: 35 EIVLKIFMHCEGCAKKIHRCLKGFEGVEDVTTDCKTSKVVVKGEKADPLKVLQRLQRKSH 94
Query: 90 RKVELIS 96
R+VELIS
Sbjct: 95 RQVELIS 101
|
|
| TAIR|locus:2167366 FP3 "farnesylated protein 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075497 AT3G02960 "AT3G02960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057951 AT2G36950 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046183 AT2G28090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2142614 AT5G03380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2121199 FP6 "farnesylated protein 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089870 AT3G21490 "AT3G21490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156927 HIPP27 "heavy metal associated isoprenylated plant protein 27" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153969 AT5G24580 "AT5G24580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pg.C_LG_XVI0018 | hypothetical protein (268 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 142 | |||
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 2e-09 | |
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 1e-07 | |
| PLN02957 | 238 | PLN02957, PLN02957, copper, zinc superoxide dismut | 3e-05 |
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
Score = 50.3 bits (121), Expect = 2e-09
Identities = 15/63 (23%), Positives = 26/63 (41%), Gaps = 1/63 (1%)
Query: 32 VLKVD-MHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGR 90
L V+ M C C K+ +AL+ GV+ + D + K V+ + + +G
Sbjct: 1 ELSVEGMTCAGCVSKIEKALEKLPGVESVEVDLETGKATVEYDPEVSPEELLEAIEDAGY 60
Query: 91 KVE 93
K
Sbjct: 61 KAR 63
|
HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions. Length = 63 |
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.46 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 99.39 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 99.32 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 99.08 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 98.48 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 98.29 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 98.01 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 97.8 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 97.23 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 96.94 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 96.9 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 96.62 | |
| COG1888 | 97 | Uncharacterized protein conserved in archaea [Func | 92.92 | |
| TIGR02052 | 92 | MerP mercuric transport protein periplasmic compon | 92.78 | |
| PF02680 | 95 | DUF211: Uncharacterized ArCR, COG1888; InterPro: I | 92.78 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 88.97 | |
| PF01883 | 72 | DUF59: Domain of unknown function DUF59; InterPro: | 84.36 | |
| cd00371 | 63 | HMA Heavy-metal-associated domain (HMA) is a conse | 82.98 |
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
Probab=99.46 E-value=5.1e-13 Score=85.52 Aligned_cols=59 Identities=34% Similarity=0.579 Sum_probs=53.8
Q ss_pred EEEE-eccchhHHHHHHHHhhCCCCccEEEEecCCCEEEEecc--CCCHHHHHHHHHhccCCc
Q 032393 32 VLKV-DMHCEACARKVARALKGFEGVDDITADSKASKVVVKGK--TADPIKVCERLQKKSGRK 91 (142)
Q Consensus 32 ~lkV-~M~C~~Ca~kIekaL~~i~GV~~V~vd~~~~kVtV~g~--~vd~~~I~~~I~kk~G~~ 91 (142)
+|+| +|+|.+|+++|+++|.+++||.++.+|+.+++++|.++ .+++..|..+|+ ++||.
T Consensus 1 t~~v~~m~C~~C~~~v~~~l~~~~GV~~v~vd~~~~~v~v~~~~~~~~~~~i~~~i~-~~Gy~ 62 (62)
T PF00403_consen 1 TFKVPGMTCEGCAKKVEKALSKLPGVKSVKVDLETKTVTVTYDPDKTSIEKIIEAIE-KAGYE 62 (62)
T ss_dssp EEEEESTTSHHHHHHHHHHHHTSTTEEEEEEETTTTEEEEEESTTTSCHHHHHHHHH-HTTSE
T ss_pred CEEECCcccHHHHHHHHHHHhcCCCCcEEEEECCCCEEEEEEecCCCCHHHHHHHHH-HhCcC
Confidence 5889 59999999999999999999999999999999999876 246799999999 89984
|
These proteins provide an important focus for research, some being involved in bacterial resistance to toxic metals, such as lead and cadmium, while others are involved in inherited human syndromes, such as Wilson's and Menke's diseases []. A conserved domain has been found in a number of these heavy metal transport or detoxification proteins []. The domain, which has been termed Heavy-Metal-Associated (HMA), contains two conserved cysteines that are probably involved in metal binding. Structure solution of the fourth HMA domain of the Menke's copper transporting ATPase shows a well-defined structure comprising a four-stranded antiparallel beta-sheet and two alpha helices packed in an alpha-beta sandwich fold []. This fold is common to other domains and is classified as "ferredoxin-like".; GO: 0046872 metal ion binding, 0030001 metal ion transport; PDB: 2VOY_A 1P6T_A 1KQK_A 2RML_A 1JWW_A 3K7R_F 1FES_A 1CC8_A 1FD8_A 2GGP_A .... |
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1888 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02052 MerP mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PF01883 DUF59: Domain of unknown function DUF59; InterPro: IPR002744 This family includes prokaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 142 | |||
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 3e-16 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 4e-15 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 8e-14 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 1e-10 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 3e-09 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 2e-06 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 1e-05 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 2e-05 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 3e-05 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 5e-05 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 6e-05 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 1e-04 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 1e-04 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 1e-04 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 2e-04 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 2e-04 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 6e-04 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 8e-04 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 9e-04 |
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 | Back alignment and structure |
|---|
Score = 71.2 bits (174), Expect = 3e-16
Identities = 15/80 (18%), Positives = 29/80 (36%), Gaps = 2/80 (2%)
Query: 26 EETPEIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQ 85
+T E + MHCE C + LK G++ + D + + V+ + P + L+
Sbjct: 3 NDTYEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVES-SVAPSTIINTLR 61
Query: 86 KKSGRKVELISPLPKPPPPD 105
G+ +
Sbjct: 62 -NCGKDAIIRGAGKPNSSAV 80
|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 99.6 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 99.49 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.46 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.46 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 99.39 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 99.39 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 99.29 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 99.26 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 99.25 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 99.25 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 99.24 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 99.24 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 99.24 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 99.22 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 99.22 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 99.21 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 99.19 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 99.19 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 99.18 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 99.18 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 99.18 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 99.17 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 99.16 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 99.15 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 99.15 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 99.14 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 99.14 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 99.12 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 99.12 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 99.11 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 99.09 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 99.08 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 99.08 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 99.06 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 98.97 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 98.94 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 98.91 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 98.86 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 98.65 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 98.55 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.53 | |
| 2x3d_A | 96 | SSO6206; unknown function; 2.70A {Sulfolobus solfa | 91.25 | |
| 2raq_A | 97 | Conserved protein MTH889; alpha-beta protein, stru | 88.55 | |
| 3bpd_A | 100 | Uncharacterized protein; heptamer, Mg+2 ION, PSI-2 | 87.77 | |
| 3cq1_A | 103 | Putative uncharacterized protein TTHB138; DTDP-4-k | 80.07 | |
| 3lno_A | 108 | Putative uncharacterized protein; alpha-beta fold, | 80.04 |
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
Probab=99.60 E-value=4.2e-15 Score=95.01 Aligned_cols=66 Identities=29% Similarity=0.502 Sum_probs=62.6
Q ss_pred ceEEEEEeccchhHHHHHHHHhhCCCCccEEEEecCCCEEEEeccCCCHHHHHHHHHhccCCcEEEcCC
Q 032393 29 PEIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELISP 97 (142)
Q Consensus 29 ~~i~lkV~M~C~~Ca~kIekaL~~i~GV~~V~vd~~~~kVtV~g~~vd~~~I~~~I~kk~G~~aelis~ 97 (142)
.++.|.|+|+|.+|+.+|+++|.+++|| ++.+|+.+++++|.+. +++..|..+|+ ++||.+.++++
T Consensus 2 ~~~~~~vgm~C~~C~~~i~~~l~~~~gV-~v~v~~~~~~~~v~~~-~~~~~i~~~i~-~~Gy~~~~~~~ 67 (68)
T 3iwl_A 2 PKHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESE-HSMDTLLATLK-KTGKTVSYLGL 67 (68)
T ss_dssp CEEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEES-SCHHHHHHHHH-TTCSCEEEEEC
T ss_pred ceEEEEECcCcHHHHHHHHHHHHcCCCe-EEEEEcCCCEEEEEec-CCHHHHHHHHH-HcCCceEecCC
Confidence 4678889999999999999999999999 9999999999999997 89999999999 89999999986
|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1 | Back alignment and structure |
|---|
| >3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1 | Back alignment and structure |
|---|
| >3cq1_A Putative uncharacterized protein TTHB138; DTDP-4-keto-L-rhamnose reductase, plasmid, oxidoreductase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2cu6_A 3cq2_A 3cq3_A* | Back alignment and structure |
|---|
| >3lno_A Putative uncharacterized protein; alpha-beta fold, structural genomics, center for structural genomics of infectious diseases, csgid; 2.10A {Bacillus anthracis} SCOP: d.52.8.0 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 142 | ||||
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 5e-11 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 3e-09 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 4e-07 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 4e-07 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 5e-07 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 1e-06 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 2e-06 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 5e-06 | |
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 6e-06 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 3e-05 | |
| d1cpza_ | 68 | d.58.17.1 (A:) Copper chaperone {Enterococcus hira | 5e-05 | |
| d1p6ta2 | 79 | d.58.17.1 (A:73-151) Potential copper-translocatin | 9e-05 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 1e-04 | |
| d1q8la_ | 84 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 0.003 |
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: Copper chaperone for superoxide dismutase, N-terminal domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 52.9 bits (127), Expect = 5e-11
Identities = 15/68 (22%), Positives = 29/68 (42%), Gaps = 2/68 (2%)
Query: 27 ETPEIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQK 86
+T E + MHCE C + LK G++ + D + + V+ + P + L +
Sbjct: 4 DTYEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVES-SVAPSTIINTL-R 61
Query: 87 KSGRKVEL 94
G+ +
Sbjct: 62 NCGKDAII 69
|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.7 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.68 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 99.67 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.56 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.55 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.54 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.54 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.53 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.53 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.53 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.48 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.48 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.47 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.45 | |
| d3bpda1 | 91 | Uncharacterized protein AF1549 {Archaeoglobus fulg | 92.1 | |
| d2raqa1 | 93 | Uncharacterized protein MTH889 {Methanobacterium t | 89.67 | |
| d1uwda_ | 102 | Hypothetical protein TM0487 {Thermotoga maritima [ | 82.04 |
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: ATX1 metallochaperone protein (ATOX1) species: Human (Homo sapiens), HAH1 [TaxId: 9606]
Probab=99.70 E-value=2.2e-17 Score=106.28 Aligned_cols=64 Identities=28% Similarity=0.490 Sum_probs=61.1
Q ss_pred eEEEEEeccchhHHHHHHHHhhCCCCccEEEEecCCCEEEEeccCCCHHHHHHHHHhccCCcEEEcC
Q 032393 30 EIVLKVDMHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELIS 96 (142)
Q Consensus 30 ~i~lkV~M~C~~Ca~kIekaL~~i~GV~~V~vd~~~~kVtV~g~~vd~~~I~~~I~kk~G~~aelis 96 (142)
+++|+|+|||.+|+++|+++|.+++|+ ++.+|+.+++++|.|+ ++++.|+.+|+ ++||.+.+++
T Consensus 2 k~ef~V~M~C~~C~~~I~~aL~~~~gv-~v~v~~~~~~v~V~~~-~~~~~i~~~I~-~~Gy~a~lig 65 (66)
T d1fe0a_ 2 KHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESE-HSMDTLLATLK-KTGKTVSYLG 65 (66)
T ss_dssp EEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEES-SCHHHHHHHHH-TTTSCEEEEE
T ss_pred CEEEEEccCchHHHHHHHHHHhcCCCc-EEEEEcCCCEEEEEee-CCHHHHHHHHH-HhCCeEEEee
Confidence 578999999999999999999999998 6999999999999998 99999999999 8999999985
|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|