Citrus Sinensis ID: 032413

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MAAQNKISHQVGEFQNDVFRFDIHGVKSDIVGSHPLETLCQSAKQREEEIKRRILVNTYGTAFPMKMDFDRQILSRFQRPTGAIPSSMLGLEAVTGSLEDFGFEHYLNDPRESESFRPADLHHGMEVRIGLSKGPAYPSFI
cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccHHHHHHHcccccccccccccccccccccccccccHHHHHHHHcccccccccccc
**********VGEFQNDVFRFDIHGVKSDIVGSHPLETLCQSAKQREEEIKRRILVNTYGTAFPMKMDFDRQILSRFQRPTGAIPSSMLGLEAVTGSLEDFGFEHYLND*************HGMEVRIGLSKGPAYPS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAQNKISHQVGEFQNDVFRFDIHGVKSDIVGSHPLETLCQSAKQREEEIKRRILVNTYGTAFPMKMDFDRQILSRFQRPTGAIPSSMLGLEAVTGSLEDFGFEHYLNDPRESESFRPADLHHGMEVRIGLSKGPAYPSFI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proteasome maturation protein Molecular chaperone essential for the assembly of standard proteasomes and immunoproteasomes. Degraded after completion of proteasome maturation (By similarity). Mediates the association of 20S preproteasome with the endoplasmic reticulum.probableQ9CQT5
Proteasome maturation protein Molecular chaperone essential for the assembly of standard proteasomes and immunoproteasomes. Degraded after completion of proteasome maturation (By similarity). Mediates the association of 20S preproteasome with the endoplasmic reticulum.probableQ3SZV5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted