Citrus Sinensis ID: 032460

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MLQLSCNLHRPSQPLLLPRHYLSPISFPINHVKFNVNKEFVKITKIWTAIGAKKGGDRSSEEGANSEKWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSKGRIIYRLRNKISSD
ccccccccccccccCECccccccccccccccccccccEEEEEcEEEEEccccccccccccccccccccEEEEEEEEECccccEEEEEEccccEEEEEEcccEEEEEEEccccccEEEEEccccccccEEEEEEccccccc
*********RPSQPLLLPRHYLSPISFPINHVKFNVNKEFVKITKIWTAIG****************KWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSKGRIIYRLR******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQLSCNLHRPSQPLLLPRHYLSPISFPINHVKFNVNKEFVKITKIWTAIGAKKGGDRSSEEGANSEKWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSKGRIIYRLRNKISSD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Translation initiation factor IF-1, chloroplastic No specific function has so far been attributed to this initiation factor; however, it seems to stimulate more or less all the activities of the other two initiation factors, IF-2 and IF-3.probableQ0ZIY4
Translation initiation factor IF-1, chloroplastic No specific function has so far been attributed to this initiation factor; however, it seems to stimulate more or less all the activities of the other two initiation factors, IF-2 and IF-3.probableQ94KR7
Translation initiation factor IF-1, chloroplastic No specific function has so far been attributed to this initiation factor; however, it seems to stimulate more or less all the activities of the other two initiation factors, IF-2 and IF-3.probableO82499

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I4O, chain A
Confidence level:very confident
Coverage over the Query: 67-134
View the alignment between query and template
View the model in PyMOL